BLASTX nr result
ID: Cephaelis21_contig00023843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023843 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626286.1| Xaa-Pro aminopeptidase [Medicago truncatula]... 49 1e-06 >ref|XP_003626286.1| Xaa-Pro aminopeptidase [Medicago truncatula] gi|355501301|gb|AES82504.1| Xaa-Pro aminopeptidase [Medicago truncatula] Length = 713 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = -2 Query: 194 NCPSSISIAAKFLSEFRKKSTANFDLDPKICTLLELFSKPSINID 60 NC +S SI+AK S+ RK ++N D DPK+ L LFSKP ++ID Sbjct: 56 NCTTSNSISAKPSSQLRKNRSSNSDSDPKLTALRRLFSKPDVSID 100 Score = 28.9 bits (63), Expect(2) = 1e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 61 IDAYIIPSQDAH 26 IDAYIIPSQDAH Sbjct: 99 IDAYIIPSQDAH 110