BLASTX nr result
ID: Cephaelis21_contig00023679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023679 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513901.1| conserved hypothetical protein [Ricinus comm... 82 3e-14 ref|XP_004161949.1| PREDICTED: uncharacterized protein LOC101232... 59 3e-07 >ref|XP_002513901.1| conserved hypothetical protein [Ricinus communis] gi|223546987|gb|EEF48484.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/85 (45%), Positives = 57/85 (67%) Frame = -3 Query: 428 KIKEVVKVLLDTQKYDIEYISDEPDVFICSVEKRLKPRLRALKILECRDFLEQRPRLSTV 249 KIK+V K+LL+ DI YI PD+ ICSV +RLKPRL L++LE + L+++P ++ Sbjct: 291 KIKDVTKLLLNVGNLDISYIVRHPDLLICSVNQRLKPRLAVLQVLENKKLLQKKPSFTSF 350 Query: 248 YKASDAQFCDWFVCPYLDEVAELKL 174 +K S +QF +V PY DE+ +L L Sbjct: 351 FKISGSQFLHKYVIPYSDELGDLSL 375 >ref|XP_004161949.1| PREDICTED: uncharacterized protein LOC101232636 [Cucumis sativus] Length = 398 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/89 (30%), Positives = 55/89 (61%) Frame = -3 Query: 428 KIKEVVKVLLDTQKYDIEYISDEPDVFICSVEKRLKPRLRALKILECRDFLEQRPRLSTV 249 K+K+V +T K+D + P +F CSV+KRL+PR + L++L+ ++ L+ R +++++ Sbjct: 236 KMKDVADFCFNTAKFDTRTLISYPVLFKCSVDKRLQPRYKVLEVLKVKNLLKNR-KIASI 294 Query: 248 YKASDAQFCDWFVCPYLDEVAELKLLYEN 162 + + F + +V +LDE+ L +Y + Sbjct: 295 FLKGEKTFVEKYVVKHLDEIPNLMDIYRD 323