BLASTX nr result
ID: Cephaelis21_contig00023665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023665 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533177.1| kinase, putative [Ricinus communis] gi|22352... 75 7e-12 ref|XP_002533173.1| kinase, putative [Ricinus communis] gi|22352... 75 7e-12 ref|XP_003551157.1| PREDICTED: U-box domain-containing protein 3... 74 2e-11 ref|XP_003603561.1| U-box domain-containing protein [Medicago tr... 74 2e-11 gb|AFO66517.1| putative kinase [Brassica napus] 73 2e-11 >ref|XP_002533177.1| kinase, putative [Ricinus communis] gi|223527026|gb|EEF29214.1| kinase, putative [Ricinus communis] Length = 565 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 247 QVEVLSCIRHPHMVLLLGACPEYGCLVYEYMSNG 348 +VEVLSCIRHPHMVLLLGACPEYGCLVYEYM NG Sbjct: 460 EVEVLSCIRHPHMVLLLGACPEYGCLVYEYMDNG 493 >ref|XP_002533173.1| kinase, putative [Ricinus communis] gi|223527022|gb|EEF29210.1| kinase, putative [Ricinus communis] Length = 752 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 247 QVEVLSCIRHPHMVLLLGACPEYGCLVYEYMSNG 348 +VEVLSCIRHPHMVLLLGACPEYGCLVYEYM NG Sbjct: 460 EVEVLSCIRHPHMVLLLGACPEYGCLVYEYMDNG 493 >ref|XP_003551157.1| PREDICTED: U-box domain-containing protein 35-like [Glycine max] Length = 800 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 247 QVEVLSCIRHPHMVLLLGACPEYGCLVYEYMSNG 348 +VEVLSCIRHP+MVLLLGACPEYGCLVYEYMSNG Sbjct: 527 EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNG 560 >ref|XP_003603561.1| U-box domain-containing protein [Medicago truncatula] gi|355492609|gb|AES73812.1| U-box domain-containing protein [Medicago truncatula] Length = 831 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 247 QVEVLSCIRHPHMVLLLGACPEYGCLVYEYMSNG 348 +VEVLSCIRHP+MVLLLGACPEYGCLVYEYMSNG Sbjct: 507 EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNG 540 >gb|AFO66517.1| putative kinase [Brassica napus] Length = 1266 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 247 QVEVLSCIRHPHMVLLLGACPEYGCLVYEYMSNG 348 +VEVLSCIRHPHMVLLLGACPEYGCLVYE+M NG Sbjct: 967 EVEVLSCIRHPHMVLLLGACPEYGCLVYEFMENG 1000