BLASTX nr result
ID: Cephaelis21_contig00023650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023650 (2379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo sub... 60 3e-06 gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo sub... 60 3e-06 gb|AFK44525.1| unknown [Medicago truncatula] 60 3e-06 ref|XP_003627715.1| ADP,ATP carrier protein [Medicago truncatula... 60 3e-06 ref|XP_004173083.1| PREDICTED: ADP,ATP carrier protein 1, mitoch... 59 5e-06 >gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo subsp. melo] Length = 390 Score = 60.1 bits (144), Expect = 3e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 6 EKGNFWVDFLMGGVSAAVSKTAAAPIERVKVL 101 EKGNF +DFLMGGVSAAVSKTAAAPIERVK+L Sbjct: 86 EKGNFMIDFLMGGVSAAVSKTAAAPIERVKLL 117 >gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo subsp. melo] Length = 390 Score = 60.1 bits (144), Expect = 3e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 6 EKGNFWVDFLMGGVSAAVSKTAAAPIERVKVL 101 EKGNF +DFLMGGVSAAVSKTAAAPIERVK+L Sbjct: 86 EKGNFMIDFLMGGVSAAVSKTAAAPIERVKLL 117 >gb|AFK44525.1| unknown [Medicago truncatula] Length = 365 Score = 59.7 bits (143), Expect = 3e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 6 EKGNFWVDFLMGGVSAAVSKTAAAPIERVKVL 101 EKGNF VDFLMGGVSAAVSKTAAAPIER+K+L Sbjct: 60 EKGNFLVDFLMGGVSAAVSKTAAAPIERIKLL 91 >ref|XP_003627715.1| ADP,ATP carrier protein [Medicago truncatula] gi|355521737|gb|AET02191.1| ADP,ATP carrier protein [Medicago truncatula] Length = 399 Score = 59.7 bits (143), Expect = 3e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 6 EKGNFWVDFLMGGVSAAVSKTAAAPIERVKVL 101 EKGNF VDFLMGGVSAAVSKTAAAPIER+K+L Sbjct: 94 EKGNFLVDFLMGGVSAAVSKTAAAPIERIKLL 125 >ref|XP_004173083.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like, partial [Cucumis sativus] Length = 261 Score = 59.3 bits (142), Expect = 5e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 6 EKGNFWVDFLMGGVSAAVSKTAAAPIERVKVL 101 EKGNF +DFLMGGVSAAVSKTAAAPIERVK+L Sbjct: 86 EKGNFMLDFLMGGVSAAVSKTAAAPIERVKLL 117