BLASTX nr result
ID: Cephaelis21_contig00023630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023630 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P48502.1|QCR7_SOLTU RecName: Full=Cytochrome b-c1 complex sub... 57 2e-06 >sp|P48502.1|QCR7_SOLTU RecName: Full=Cytochrome b-c1 complex subunit 7; AltName: Full=CR14; AltName: Full=Complex III subunit 7; AltName: Full=Complex III subunit VII; AltName: Full=Ubiquinol-cytochrome c reductase complex 14 kDa protein gi|633681|emb|CAA55863.1| ubiquinol--cytochrome c reductase [Solanum tuberosum] Length = 123 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 97 MASSFSRWLLDPKRNPLAALHKKTLDHRLRRY 2 MASSFSRWL+DPK+NPLAA+H KTL RLR Y Sbjct: 1 MASSFSRWLVDPKKNPLAAIHMKTLSSRLRNY 32