BLASTX nr result
ID: Cephaelis21_contig00023447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023447 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517613.1| pentatricopeptide repeat-containing protein,... 106 2e-21 ref|NP_178132.1| pentatricopeptide repeat-containing protein [Ar... 104 1e-20 dbj|BAC43646.1| unknown protein [Arabidopsis thaliana] gi|289509... 104 1e-20 ref|XP_003597877.1| Pentatricopeptide repeat-containing protein ... 103 2e-20 ref|XP_004152207.1| PREDICTED: pentatricopeptide repeat-containi... 102 3e-20 >ref|XP_002517613.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543245|gb|EEF44777.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 400 Score = 106 bits (265), Expect = 2e-21 Identities = 46/92 (50%), Positives = 72/92 (78%) Frame = +2 Query: 5 LNDRGIEPNCKIYQTMIHYLCRAGDYDLAYTMSKNSVRKNRFPSIDTIQNLLEGLRKSGK 184 L+ +G +PN KIYQTMIH LC+ G++DLAYTM K+ ++K+ F ++DTI LL+GL+K+G+ Sbjct: 308 LHGKGYKPNVKIYQTMIHCLCKGGEFDLAYTMCKDCMKKSWFLNVDTIHTLLDGLKKNGQ 367 Query: 185 IDEARFIISLAKERTPPFSAHQMRAMESMFLR 280 +D+A+ I++LA+ R PPFS+ Q+ +S+ R Sbjct: 368 LDKAKMIVTLAQRRMPPFSSKQLSIFDSLLSR 399 >ref|NP_178132.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806404|sp|Q8GW57.2|PP134_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g80150, mitochondrial; Flags: Precursor gi|332198242|gb|AEE36363.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 397 Score = 104 bits (259), Expect = 1e-20 Identities = 44/89 (49%), Positives = 70/89 (78%) Frame = +2 Query: 5 LNDRGIEPNCKIYQTMIHYLCRAGDYDLAYTMSKNSVRKNRFPSIDTIQNLLEGLRKSGK 184 ++ +G +PN KIYQTMIHYLC+AG++DLAYTM K+ +RK +P++DT++ LL+GL K G+ Sbjct: 308 MHGKGYKPNLKIYQTMIHYLCKAGNFDLAYTMCKDCMRKKWYPNLDTVEMLLKGLVKKGQ 367 Query: 185 IDEARFIISLAKERTPPFSAHQMRAMESM 271 +D+A+ I+ L R PPF + Q+ +++S+ Sbjct: 368 LDQAKSIMELVHRRVPPFRSKQLLSLKSI 396 >dbj|BAC43646.1| unknown protein [Arabidopsis thaliana] gi|28950987|gb|AAO63417.1| At1g80150 [Arabidopsis thaliana] Length = 397 Score = 104 bits (259), Expect = 1e-20 Identities = 44/89 (49%), Positives = 70/89 (78%) Frame = +2 Query: 5 LNDRGIEPNCKIYQTMIHYLCRAGDYDLAYTMSKNSVRKNRFPSIDTIQNLLEGLRKSGK 184 ++ +G +PN KIYQTMIHYLC+AG++DLAYTM K+ +RK +P++DT++ LL+GL K G+ Sbjct: 308 MHGKGYKPNLKIYQTMIHYLCKAGNFDLAYTMCKDCMRKKWYPNLDTVEMLLKGLVKKGQ 367 Query: 185 IDEARFIISLAKERTPPFSAHQMRAMESM 271 +D+A+ I+ L R PPF + Q+ +++S+ Sbjct: 368 LDQAKSIMELVHRRVPPFRSKQLLSLKSI 396 >ref|XP_003597877.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87162918|gb|ABD28713.1| Pentatricopeptide repeat [Medicago truncatula] gi|355486925|gb|AES68128.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 439 Score = 103 bits (257), Expect = 2e-20 Identities = 48/89 (53%), Positives = 70/89 (78%) Frame = +2 Query: 5 LNDRGIEPNCKIYQTMIHYLCRAGDYDLAYTMSKNSVRKNRFPSIDTIQNLLEGLRKSGK 184 L+D+G + + IYQTMIH LC+ GD+ AYT+ K+S+RKN FP++DTI LLEGL+KSGK Sbjct: 347 LHDKGYKISANIYQTMIHNLCKRGDFSQAYTLCKDSMRKNWFPNVDTIFMLLEGLKKSGK 406 Query: 185 IDEARFIISLAKERTPPFSAHQMRAMESM 271 I++A+ I++LA+ R PPFS + +M+S+ Sbjct: 407 INKAKVIVALAEGRKPPFSFSYLASMQSI 435 >ref|XP_004152207.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Cucumis sativus] gi|449484169|ref|XP_004156805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Cucumis sativus] Length = 399 Score = 102 bits (255), Expect = 3e-20 Identities = 45/88 (51%), Positives = 70/88 (79%) Frame = +2 Query: 5 LNDRGIEPNCKIYQTMIHYLCRAGDYDLAYTMSKNSVRKNRFPSIDTIQNLLEGLRKSGK 184 L+ G +PN KIYQTMIHYLC++ D++LA+T+ K+++ KN FP+IDTI +LL+GL K G+ Sbjct: 307 LHGSGYKPNVKIYQTMIHYLCKSEDFNLAHTICKDAMNKNWFPNIDTIHSLLKGLNKMGE 366 Query: 185 IDEARFIISLAKERTPPFSAHQMRAMES 268 +A+ I++LA++R PPFS +Q+ A+ + Sbjct: 367 AGKAQLILALARKRVPPFSKNQLEALNT 394