BLASTX nr result
ID: Cephaelis21_contig00023360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023360 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -1 Query: 200 KLFMAAESLLSEKQRRVCCSWQRCSRYIQEQRTRVYIIWRCTILLLRWNE 51 K+ MAA++L + SWQRCS+ I+EQRTR+YIIWRCT++LL W++ Sbjct: 17 KIQMAADALSMRSMK--LRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 59.7 bits (143), Expect = 2e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -1 Query: 143 SWQRCSRYIQEQRTRVYIIWRCTILLLRWNE 51 SWQRCSR ++EQRTR+YIIWRCT++LL W++ Sbjct: 16 SWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46