BLASTX nr result
ID: Cephaelis21_contig00023357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023357 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sa... 80 2e-13 ref|XP_003554718.1| PREDICTED: uncharacterized protein LOC100811... 78 9e-13 ref|NP_001241122.1| uncharacterized protein LOC100802211 [Glycin... 78 9e-13 gb|AFK37486.1| unknown [Lotus japonicus] 77 1e-12 ref|XP_002273920.2| PREDICTED: protein notum homolog [Vitis vini... 77 2e-12 >ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus] Length = 539 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 137 DMDWVFVHKLWERWASSSVGSPGLPLKAALLISYDPTGPSRLLST 3 +MDW FVHK W++WAS S+G+ G PLKAALLI+YDPTGPSRLLST Sbjct: 392 EMDWAFVHKAWDKWASGSIGTFGQPLKAALLINYDPTGPSRLLST 436 >ref|XP_003554718.1| PREDICTED: uncharacterized protein LOC100811973 [Glycine max] Length = 147 Score = 77.8 bits (190), Expect = 9e-13 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWVFVHKLWERWASSSVGSPGLPLKAALLISYDPTGPSRLLST 3 MDW FVHK W++WAS+++G G PLKAALLI+YDPTGPSRLLST Sbjct: 1 MDWAFVHKTWDKWASTNIGYSGHPLKAALLINYDPTGPSRLLST 44 >ref|NP_001241122.1| uncharacterized protein LOC100802211 [Glycine max] gi|255646679|gb|ACU23813.1| unknown [Glycine max] Length = 147 Score = 77.8 bits (190), Expect = 9e-13 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWVFVHKLWERWASSSVGSPGLPLKAALLISYDPTGPSRLLST 3 MDW FVHK W++WAS+++G G PLKAALLI+YDPTGPSRLLST Sbjct: 1 MDWAFVHKTWDKWASTNIGYSGHPLKAALLINYDPTGPSRLLST 44 >gb|AFK37486.1| unknown [Lotus japonicus] Length = 147 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWVFVHKLWERWASSSVGSPGLPLKAALLISYDPTGPSRLLST 3 MDW FVHK W++WAS+++G G PLKAALLI+YDPTGPSRLLST Sbjct: 1 MDWGFVHKTWDKWASTNIGYSGYPLKAALLINYDPTGPSRLLST 44 >ref|XP_002273920.2| PREDICTED: protein notum homolog [Vitis vinifera] Length = 521 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 140 QDMDWVFVHKLWERWASSSVGSPGLPLKAALLISYDPTGPSRLLST 3 Q MDW FV K W++W S+S+GS G PLKAALLI+YDPTGPSRLLST Sbjct: 373 QLMDWTFVRKAWDKWISTSIGSSGEPLKAALLINYDPTGPSRLLST 418