BLASTX nr result
ID: Cephaelis21_contig00023100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023100 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635508.1| PREDICTED: general transcription factor IIH ... 59 5e-07 emb|CBI25914.3| unnamed protein product [Vitis vinifera] 59 5e-07 emb|CAN81292.1| hypothetical protein VITISV_005315 [Vitis vinifera] 59 5e-07 ref|XP_002519045.1| tfiih, polypeptide, putative [Ricinus commun... 56 3e-06 ref|XP_004167674.1| PREDICTED: RNA polymerase II transcription f... 54 1e-05 >ref|XP_003635508.1| PREDICTED: general transcription factor IIH subunit 4-like, partial [Vitis vinifera] Length = 209 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 373 LCCSGVLPREPLPSNVALRLPSSEELDAYAANQWECF 483 L GVLPREP+PSN+ +RLPS ++L+AYA QWECF Sbjct: 83 LIYGGVLPREPMPSNITVRLPSLDDLEAYALGQWECF 119 >emb|CBI25914.3| unnamed protein product [Vitis vinifera] Length = 225 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 373 LCCSGVLPREPLPSNVALRLPSSEELDAYAANQWECF 483 L GVLPREP+PSN+ +RLPS ++L+AYA QWECF Sbjct: 83 LIYGGVLPREPMPSNITVRLPSLDDLEAYALGQWECF 119 >emb|CAN81292.1| hypothetical protein VITISV_005315 [Vitis vinifera] Length = 451 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 373 LCCSGVLPREPLPSNVALRLPSSEELDAYAANQWECF 483 L GVLPREP+PSN+ +RLPS ++L+AYA QWECF Sbjct: 114 LIYGGVLPREPMPSNITVRLPSLDDLEAYALGQWECF 150 >ref|XP_002519045.1| tfiih, polypeptide, putative [Ricinus communis] gi|223541708|gb|EEF43256.1| tfiih, polypeptide, putative [Ricinus communis] Length = 451 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 385 GVLPREPLPSNVALRLPSSEELDAYAANQWECF 483 GVLP EPL SN+A+RLP+ EELD YA QWECF Sbjct: 118 GVLPGEPLASNIAVRLPTLEELDTYALGQWECF 150 >ref|XP_004167674.1| PREDICTED: RNA polymerase II transcription factor B subunit 2-like, partial [Cucumis sativus] Length = 296 Score = 54.3 bits (129), Expect = 1e-05 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +1 Query: 388 VLPREPLPSNVALRLPSSEELDAYAANQWECF 483 VL REP+PSN+ +RLPS E+L+AYA +QWECF Sbjct: 119 VLAREPMPSNITVRLPSLEDLEAYALDQWECF 150