BLASTX nr result
ID: Cephaelis21_contig00022945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022945 (876 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165860.1| PREDICTED: transcription factor TCP7-like [C... 74 4e-11 ref|XP_004145813.1| PREDICTED: transcription factor TCP7-like [C... 74 4e-11 ref|XP_004156285.1| PREDICTED: transcription factor TCP11-like [... 72 1e-10 ref|XP_004143267.1| PREDICTED: transcription factor TCP11-like [... 72 1e-10 ref|XP_002519510.1| conserved hypothetical protein [Ricinus comm... 71 4e-10 >ref|XP_004165860.1| PREDICTED: transcription factor TCP7-like [Cucumis sativus] Length = 186 Score = 73.9 bits (180), Expect = 4e-11 Identities = 42/68 (61%), Positives = 49/68 (72%) Frame = -1 Query: 660 PNSPLPSSEDKRRNSKDNKGRRQCCKAKANKRSGHRVRLPPLCAARIFQLTRELGNRTHG 481 PNSP+ +SE K SK K R AK + R R+RLPPLCAAR+FQLTRELGN+T G Sbjct: 22 PNSPI-ASESKLIPSKAPKDRH----AKVHGRD-RRIRLPPLCAARVFQLTRELGNKTDG 75 Query: 480 QTVEWLLR 457 QTVEWLL+ Sbjct: 76 QTVEWLLK 83 >ref|XP_004145813.1| PREDICTED: transcription factor TCP7-like [Cucumis sativus] Length = 186 Score = 73.9 bits (180), Expect = 4e-11 Identities = 42/68 (61%), Positives = 49/68 (72%) Frame = -1 Query: 660 PNSPLPSSEDKRRNSKDNKGRRQCCKAKANKRSGHRVRLPPLCAARIFQLTRELGNRTHG 481 PNSP+ +SE K SK K R AK + R R+RLPPLCAAR+FQLTRELGN+T G Sbjct: 22 PNSPI-ASESKLIPSKAPKDRH----AKVHGRD-RRIRLPPLCAARVFQLTRELGNKTDG 75 Query: 480 QTVEWLLR 457 QTVEWLL+ Sbjct: 76 QTVEWLLK 83 >ref|XP_004156285.1| PREDICTED: transcription factor TCP11-like [Cucumis sativus] Length = 221 Score = 72.4 bits (176), Expect = 1e-10 Identities = 43/95 (45%), Positives = 56/95 (58%), Gaps = 6/95 (6%) Frame = -1 Query: 723 SSSSP------CSDELAFAQSNPIQLAPNSPLPSSEDKRRNSKDNKGRRQCCKAKANKRS 562 SSS P S + + S+P+ + S LP + +S +K R K N R Sbjct: 12 SSSDPHSQPPTASHSVVGSNSSPVTITRQSLLPRKSNTPLSSSSSKDRH----IKVNGR- 66 Query: 561 GHRVRLPPLCAARIFQLTRELGNRTHGQTVEWLLR 457 G RVR+P LCAARIFQLTRELG+R+ G+T+EWLLR Sbjct: 67 GRRVRMPALCAARIFQLTRELGHRSEGETIEWLLR 101 >ref|XP_004143267.1| PREDICTED: transcription factor TCP11-like [Cucumis sativus] Length = 207 Score = 72.4 bits (176), Expect = 1e-10 Identities = 43/95 (45%), Positives = 56/95 (58%), Gaps = 6/95 (6%) Frame = -1 Query: 723 SSSSP------CSDELAFAQSNPIQLAPNSPLPSSEDKRRNSKDNKGRRQCCKAKANKRS 562 SSS P S + + S+P+ + S LP + +S +K R K N R Sbjct: 12 SSSDPHSQPPTASHSVVGSNSSPVTITRQSLLPRKSNTPLSSSSSKDRH----IKVNGR- 66 Query: 561 GHRVRLPPLCAARIFQLTRELGNRTHGQTVEWLLR 457 G RVR+P LCAARIFQLTRELG+R+ G+T+EWLLR Sbjct: 67 GRRVRMPALCAARIFQLTRELGHRSEGETIEWLLR 101 >ref|XP_002519510.1| conserved hypothetical protein [Ricinus communis] gi|223541373|gb|EEF42924.1| conserved hypothetical protein [Ricinus communis] Length = 215 Score = 70.9 bits (172), Expect = 4e-10 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 10/93 (10%) Frame = -1 Query: 705 SDELAFAQSNPIQLAPNS-----PLPSSEDKRRNSKDNKGR-----RQCCKAKANKRSGH 556 S ++ F SN Q PN P P++E + R + GR + K N R G Sbjct: 2 SSKMIFHSSNHRQETPNLNNSLIPAPTTESQPRTQLTSHGRPTNSLSKDRHTKVNGR-GR 60 Query: 555 RVRLPPLCAARIFQLTRELGNRTHGQTVEWLLR 457 RVR+P LCAARIFQLTRELG+R+ G+T+EWLLR Sbjct: 61 RVRMPALCAARIFQLTRELGHRSDGETIEWLLR 93