BLASTX nr result
ID: Cephaelis21_contig00022789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022789 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19319.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002283634.1| PREDICTED: symplekin-like [Vitis vinifera] 59 3e-07 ref|XP_002510000.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >emb|CBI19319.3| unnamed protein product [Vitis vinifera] Length = 1063 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%), Gaps = 5/38 (13%) Frame = +1 Query: 238 VWRMPKLWVGFLKCVSQT-PHSFRVLLQ----QLEGTL 336 VWRMPKLWVGFLKCVSQT PHSFRVLLQ QLE L Sbjct: 963 VWRMPKLWVGFLKCVSQTQPHSFRVLLQLPAPQLESAL 1000 >ref|XP_002283634.1| PREDICTED: symplekin-like [Vitis vinifera] Length = 1037 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/38 (81%), Positives = 31/38 (81%), Gaps = 5/38 (13%) Frame = +1 Query: 238 VWRMPKLWVGFLKCVSQT-PHSFRVLLQ----QLEGTL 336 VWRMPKLWVGFLKCVSQT PHSFRVLLQ QLE L Sbjct: 937 VWRMPKLWVGFLKCVSQTQPHSFRVLLQLPAPQLESAL 974 >ref|XP_002510000.1| conserved hypothetical protein [Ricinus communis] gi|223550701|gb|EEF52187.1| conserved hypothetical protein [Ricinus communis] Length = 1390 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%), Gaps = 1/28 (3%) Frame = +1 Query: 238 VWRMPKLWVGFLKCVSQT-PHSFRVLLQ 318 VW+MPKLWVGFLKCVSQ PHSFRVLLQ Sbjct: 1233 VWKMPKLWVGFLKCVSQARPHSFRVLLQ 1260