BLASTX nr result
ID: Cephaelis21_contig00022701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022701 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-20 ref|XP_002524769.1| pentatricopeptide repeat-containing protein,... 96 4e-18 ref|XP_002322993.1| predicted protein [Populus trichocarpa] gi|2... 92 6e-17 ref|XP_004147968.1| PREDICTED: pentatricopeptide repeat-containi... 85 8e-15 gb|ABD33237.1| Pentatricopeptide repeat [Medicago truncatula] 84 2e-14 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 103 bits (258), Expect = 1e-20 Identities = 44/69 (63%), Positives = 57/69 (82%) Frame = -2 Query: 534 LYHCKMVMYSAQKRLADMERVIDEMDQANLHISKKTFWILYKAYTQWGEKSKLEAVVGMM 355 LYHCKMVMY++QKRL +ME V++EM+ +N +KKTFWILYKAY+ W ++ K+E V G+M Sbjct: 421 LYHCKMVMYASQKRLEEMESVLNEMESSNFCCTKKTFWILYKAYSMWDQRHKVEQVKGLM 480 Query: 354 CKHGYEIPS 328 CKHGY IPS Sbjct: 481 CKHGYGIPS 489 >ref|XP_002524769.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535953|gb|EEF37612.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 509 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/74 (59%), Positives = 58/74 (78%) Frame = -2 Query: 534 LYHCKMVMYSAQKRLADMERVIDEMDQANLHISKKTFWILYKAYTQWGEKSKLEAVVGMM 355 LYHCKMVMY+++KRL +ME V+++M+ NL +KKTF ILYKAY G+K K+E V+G+M Sbjct: 436 LYHCKMVMYASEKRLDEMESVLNDMENFNLGRTKKTFVILYKAYLMCGKKYKVEQVLGLM 495 Query: 354 CKHGYEIPSGAPSS 313 KHGYE+P GA S Sbjct: 496 YKHGYEVPEGASPS 509 >ref|XP_002322993.1| predicted protein [Populus trichocarpa] gi|222867623|gb|EEF04754.1| predicted protein [Populus trichocarpa] Length = 360 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/68 (61%), Positives = 50/68 (73%) Frame = -2 Query: 534 LYHCKMVMYSAQKRLADMERVIDEMDQANLHISKKTFWILYKAYTQWGEKSKLEAVVGMM 355 L+HCKMVMY QKRL +ME V+ EM+ NL +KKTFWILYKAY G+ K+E V G+M Sbjct: 287 LFHCKMVMYGTQKRLDEMESVLIEMENCNLPRTKKTFWILYKAYLNCGQWYKVEQVAGLM 346 Query: 354 CKHGYEIP 331 CKHGY P Sbjct: 347 CKHGYGNP 354 >ref|XP_004147968.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Cucumis sativus] gi|449494249|ref|XP_004159492.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Cucumis sativus] Length = 514 Score = 84.7 bits (208), Expect = 8e-15 Identities = 43/74 (58%), Positives = 52/74 (70%) Frame = -2 Query: 534 LYHCKMVMYSAQKRLADMERVIDEMDQANLHISKKTFWILYKAYTQWGEKSKLEAVVGMM 355 LYHCKMVM+++Q RL +ME V+DEM NL SKKTF+ILYKAY+ G + K VV M Sbjct: 439 LYHCKMVMFASQNRLEEMECVLDEMKNFNLDWSKKTFYILYKAYSTSGCRYKANQVVCRM 498 Query: 354 CKHGYEIPSGAPSS 313 CK GY +P G SS Sbjct: 499 CKLGYGVPVGWDSS 512 >gb|ABD33237.1| Pentatricopeptide repeat [Medicago truncatula] Length = 514 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/71 (49%), Positives = 51/71 (71%) Frame = -2 Query: 534 LYHCKMVMYSAQKRLADMERVIDEMDQANLHISKKTFWILYKAYTQWGEKSKLEAVVGMM 355 LYH K+VMY +QK L +M+ V++EMD N+ +KKT WI+YKAY G++S + ++G M Sbjct: 441 LYHSKLVMYGSQKNLREMQNVLEEMDSVNIQRTKKTMWIMYKAYWNCGQRSMVLKILGQM 500 Query: 354 CKHGYEIPSGA 322 KHG+E+P A Sbjct: 501 FKHGHEVPIDA 511