BLASTX nr result
ID: Cephaelis21_contig00022695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022695 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG29318.1| Xyloglucan endo-transglycosylase C-terminus famil... 102 4e-20 ref|XP_004163204.1| PREDICTED: probable xyloglucan endotransgluc... 87 1e-15 ref|XP_004136205.1| PREDICTED: probable xyloglucan endotransgluc... 87 1e-15 ref|XP_002326748.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 gb|AFK40626.1| unknown [Lotus japonicus] 85 7e-15 >gb|ABG29318.1| Xyloglucan endo-transglycosylase C-terminus family protein [Solanum bulbocastanum] Length = 178 Score = 102 bits (253), Expect = 4e-20 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +3 Query: 3 RKGMKWFRETYMYYSYCYDNLRYNVPPPECVIVPSEKERFRDSGRLREKMRFGGS 167 RK MK+FRE YMYYSYCYDNLRY VPPPECVIV SE++ FRDSGRLR+KM+FGGS Sbjct: 83 RKSMKFFRERYMYYSYCYDNLRYPVPPPECVIVQSERDLFRDSGRLRQKMKFGGS 137 >ref|XP_004163204.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 30-like [Cucumis sativus] Length = 348 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = +3 Query: 3 RKGMKWFRETYMYYSYCYDNLRYNVPPPECVIVPSEKERFRDSGRLREKMRFGGS 167 R M+ FR+ YMYYSYCYD LRY+VPPPECVI+PSEK+RF+DSGRL +FGGS Sbjct: 276 RAAMRNFRQHYMYYSYCYDTLRYSVPPPECVIIPSEKQRFKDSGRL----KFGGS 326 >ref|XP_004136205.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 30-like [Cucumis sativus] Length = 348 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = +3 Query: 3 RKGMKWFRETYMYYSYCYDNLRYNVPPPECVIVPSEKERFRDSGRLREKMRFGGS 167 R M+ FR+ YMYYSYCYD LRY+VPPPECVI+PSEK+RF+DSGRL +FGGS Sbjct: 276 RAAMRNFRQHYMYYSYCYDTLRYSVPPPECVIIPSEKQRFKDSGRL----KFGGS 326 >ref|XP_002326748.1| predicted protein [Populus trichocarpa] gi|222834070|gb|EEE72547.1| predicted protein [Populus trichocarpa] Length = 322 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = +3 Query: 3 RKGMKWFRETYMYYSYCYDNLRYNVPPPECVIVPSEKERFRDSGRLREKMRFGGS 167 R M+ FR+ YMYYSYCYD+LRY VPPPECV++P+EK+RFRD+GRL RFGGS Sbjct: 248 RSAMRKFRQRYMYYSYCYDSLRYPVPPPECVVIPTEKDRFRDTGRL----RFGGS 298 >gb|AFK40626.1| unknown [Lotus japonicus] Length = 354 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/55 (67%), Positives = 46/55 (83%) Frame = +3 Query: 3 RKGMKWFRETYMYYSYCYDNLRYNVPPPECVIVPSEKERFRDSGRLREKMRFGGS 167 R M+ FR+ YMYYSYCYD LRY+VPPPECVI+P+EK+RF+++GRL RFGGS Sbjct: 280 RLAMRRFRQRYMYYSYCYDTLRYSVPPPECVIIPAEKQRFKETGRL----RFGGS 330