BLASTX nr result
ID: Cephaelis21_contig00022635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022635 (1064 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN59715.1| hypothetical protein VITISV_006076 [Vitis vinifera] 62 2e-07 >emb|CAN59715.1| hypothetical protein VITISV_006076 [Vitis vinifera] Length = 1102 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = -1 Query: 674 ILHQSVCKHDIQPPPILWHENTAVVRRGFSHRRLPKKSVSGPHLAKLAHQLVLQKCMTKM 495 +LH +V K + PP+LWHE +AV R FS R +P SVSGP LAKLAH+LV + C+ K Sbjct: 955 LLH-TVIKPHLLRPPVLWHETSAVCGRKFSERPIP-NSVSGPCLAKLAHRLVFEYCLAKR 1012 Query: 494 Q 492 Q Sbjct: 1013 Q 1013