BLASTX nr result
ID: Cephaelis21_contig00022592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022592 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265565.2| PREDICTED: F-box protein At-B-like [Vitis vi... 73 3e-11 emb|CBI39868.3| unnamed protein product [Vitis vinifera] 73 3e-11 emb|CAC36388.1| hypothetical protein [Capsella rubella] 56 3e-06 ref|NP_175955.1| F-box protein At-B [Arabidopsis thaliana] gi|75... 55 5e-06 emb|CAC36384.1| hypothetical protein [Arabidopsis thaliana] 55 5e-06 >ref|XP_002265565.2| PREDICTED: F-box protein At-B-like [Vitis vinifera] Length = 619 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/55 (67%), Positives = 42/55 (76%) Frame = +3 Query: 111 LEGLPDSLITEIVQKLDLESLCSGACVSRTFRSCVSQVLSTRSSLDLSAFSPDAE 275 LEGLP +LI EI+ KLD E+LCS ACVSR R VS+ L SSLDLSAFSPDA+ Sbjct: 18 LEGLPTTLINEIIVKLDTETLCSVACVSRALRFAVSEALPLSSSLDLSAFSPDAQ 72 >emb|CBI39868.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/55 (67%), Positives = 42/55 (76%) Frame = +3 Query: 111 LEGLPDSLITEIVQKLDLESLCSGACVSRTFRSCVSQVLSTRSSLDLSAFSPDAE 275 LEGLP +LI EI+ KLD E+LCS ACVSR R VS+ L SSLDLSAFSPDA+ Sbjct: 6 LEGLPTTLINEIIVKLDTETLCSVACVSRALRFAVSEALPLSSSLDLSAFSPDAQ 60 >emb|CAC36388.1| hypothetical protein [Capsella rubella] Length = 606 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/49 (63%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +3 Query: 132 LITEIVQKLDLESLCSGACVSRTFRSC-VSQVLSTRSSLDLSAFSPDAE 275 L EI+++LDLE+LCS ACVS T RS VS VL + +SLDLS FSPD E Sbjct: 9 LAEEILKRLDLENLCSVACVSTTLRSAVVSGVLPSLTSLDLSVFSPDEE 57 >ref|NP_175955.1| F-box protein At-B [Arabidopsis thaliana] gi|75339120|sp|Q9ZWC6.1|ATB_ARATH RecName: Full=F-box protein At-B gi|8778504|gb|AAF79512.1|AC002328_20 F20N2.2 [Arabidopsis thaliana] gi|20856547|gb|AAM26672.1| At1g55590/F20N2_18 [Arabidopsis thaliana] gi|24111385|gb|AAN46816.1| At1g55590/F20N2_18 [Arabidopsis thaliana] gi|332195148|gb|AEE33269.1| F-box protein At-B [Arabidopsis thaliana] Length = 607 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/49 (63%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +3 Query: 132 LITEIVQKLDLESLCSGACVSRTFRSC-VSQVLSTRSSLDLSAFSPDAE 275 L EI+++LDLE+LCS ACVS T RS VS VL + +SLDLS FSPD E Sbjct: 9 LAEEILKRLDLENLCSVACVSTTLRSAVVSGVLPSLTSLDLSVFSPDDE 57 >emb|CAC36384.1| hypothetical protein [Arabidopsis thaliana] Length = 601 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/49 (63%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +3 Query: 132 LITEIVQKLDLESLCSGACVSRTFRSC-VSQVLSTRSSLDLSAFSPDAE 275 L EI+++LDLE+LCS ACVS T RS VS VL + +SLDLS FSPD E Sbjct: 3 LAEEILKRLDLENLCSVACVSTTLRSAVVSGVLPSLTSLDLSVFSPDDE 51