BLASTX nr result
ID: Cephaelis21_contig00022574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022574 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK00827.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 1e-08 ref|XP_002874654.1| hypothetical protein ARALYDRAFT_489930 [Arab... 64 1e-08 ref|NP_192830.1| RNA polymerase II transcriptional coactivator K... 62 5e-08 ref|NP_001238108.1| uncharacterized protein LOC100499671 [Glycin... 61 8e-08 ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional... 60 2e-07 >dbj|BAK00827.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 190 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 8 LTIGELSKSRRVTLTEFKGKTLVSIREFYSKEGKELPTSKG 130 L I LSKSRRVTL EFKG TLVSIRE+Y K+GKE+PTSKG Sbjct: 121 LIICRLSKSRRVTLQEFKGMTLVSIREYYLKDGKEMPTSKG 161 >ref|XP_002874654.1| hypothetical protein ARALYDRAFT_489930 [Arabidopsis lyrata subsp. lyrata] gi|297320491|gb|EFH50913.1| hypothetical protein ARALYDRAFT_489930 [Arabidopsis lyrata subsp. lyrata] Length = 165 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +2 Query: 8 LTIGELSKSRRVTLTEFKGKTLVSIREFYSKEGKELPTSKG 130 L I LS RRVT+ EFKGKTLVSIRE+Y K+GKELPTSKG Sbjct: 96 LIIWRLSDKRRVTIQEFKGKTLVSIREYYKKDGKELPTSKG 136 >ref|NP_192830.1| RNA polymerase II transcriptional coactivator KELP [Arabidopsis thaliana] gi|145333013|ref|NP_001078372.1| RNA polymerase II transcriptional coactivator KELP [Arabidopsis thaliana] gi|37079408|sp|O65155.1|KELP_ARATH RecName: Full=RNA polymerase II transcriptional coactivator KELP gi|2997686|gb|AAC08575.1| putative transcriptional co-activator [Arabidopsis thaliana] gi|3513735|gb|AAC33951.1| contains similarity to RNA polymerase II transcription cofactor p15 [Arabidopsis thaliana] gi|4539366|emb|CAB40060.1| putative protein [Arabidopsis thaliana] gi|7267790|emb|CAB81193.1| putative protein [Arabidopsis thaliana] gi|21554027|gb|AAM63108.1| putative transcriptional coactivator [Arabidopsis thaliana] gi|29028806|gb|AAO64782.1| At4g10920 [Arabidopsis thaliana] gi|110736559|dbj|BAF00245.1| hypothetical protein [Arabidopsis thaliana] gi|110738319|dbj|BAF01087.1| hypothetical protein [Arabidopsis thaliana] gi|332657543|gb|AEE82943.1| RNA polymerase II transcriptional coactivator KELP [Arabidopsis thaliana] gi|332657544|gb|AEE82944.1| RNA polymerase II transcriptional coactivator KELP [Arabidopsis thaliana] Length = 165 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 8 LTIGELSKSRRVTLTEFKGKTLVSIREFYSKEGKELPTSKG 130 L I LS RRVT+ EFKGK+LVSIRE+Y K+GKELPTSKG Sbjct: 96 LIICRLSDKRRVTIQEFKGKSLVSIREYYKKDGKELPTSKG 136 >ref|NP_001238108.1| uncharacterized protein LOC100499671 [Glycine max] gi|255625681|gb|ACU13185.1| unknown [Glycine max] Length = 163 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 8 LTIGELSKSRRVTLTEFKGKTLVSIREFYSKEGKELPTSKG 130 L I LS RRVT+ +F+GKTLVSIRE+Y K+GKELPTSKG Sbjct: 95 LIICRLSDKRRVTIQDFRGKTLVSIREYYKKDGKELPTSKG 135 >ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional coactivator KELP-like [Vitis vinifera] Length = 187 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 8 LTIGELSKSRRVTLTEFKGKTLVSIREFYSKEGKELPTSKG 130 L I LS RRVT+ +F+GKTLVSIREFY K+GKELP+SKG Sbjct: 117 LIICRLSDRRRVTIQDFRGKTLVSIREFYRKDGKELPSSKG 157