BLASTX nr result
ID: Cephaelis21_contig00021982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021982 (473 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514556.1| conserved hypothetical protein [Ricinus comm... 69 2e-11 ref|XP_002314909.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 >ref|XP_002514556.1| conserved hypothetical protein [Ricinus communis] gi|223546160|gb|EEF47662.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 69.3 bits (168), Expect(2) = 2e-11 Identities = 37/97 (38%), Positives = 50/97 (51%), Gaps = 1/97 (1%) Frame = +3 Query: 180 GKTIIGFVVPLTGAFLTPYA-PTXXXXXXXXXXXXXMGFALLWNGILLRYISPRYSNIME 356 G+ I+ VP+ AFLT Y+ +GF WNGI+LR + PR SN E Sbjct: 136 GRHILVLTVPMVTAFLTLYSRDPNSLVASLILLLLCLGFTATWNGIMLREMYPRASNATE 195 Query: 357 QIGAVLVILAVYGLISSFLPNYLLWIPWASFLMVLLP 467 QIG L+ LA + L++ FLP L WIP + + P Sbjct: 196 QIGVTLIFLAFFALVACFLPPKLAWIPLLYLALCIFP 232 Score = 23.9 bits (50), Expect(2) = 2e-11 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = +2 Query: 131 EVLNPIAKIFKEQDLGR 181 +VL+PI ++F+ +++GR Sbjct: 121 QVLDPITRVFQNKEMGR 137 >ref|XP_002314909.1| predicted protein [Populus trichocarpa] gi|222863949|gb|EEF01080.1| predicted protein [Populus trichocarpa] Length = 243 Score = 62.0 bits (149), Expect = 5e-08 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 1/97 (1%) Frame = +3 Query: 180 GKTIIGFVVPLT-GAFLTPYAPTXXXXXXXXXXXXXMGFALLWNGILLRYISPRYSNIME 356 G+ ++ VP+T G F +GF +WNGILLR S+I+E Sbjct: 119 GRHVLILAVPMTIGLFSVDKLVNEPLALRVMAIALALGFVGIWNGILLRTSCNEASSIIE 178 Query: 357 QIGAVLVILAVYGLISSFLPNYLLWIPWASFLMVLLP 467 +G ++LA +G I+ FLP L+WIP+ +++ LLP Sbjct: 179 LLGIAFMLLAFFGFIACFLPESLIWIPYLCWVLSLLP 215