BLASTX nr result
ID: Cephaelis21_contig00021878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021878 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW75541.1| hypothetical protein ZEAMMB73_660971 [Zea mays] 64 2e-08 gb|AFW75540.1| hypothetical protein ZEAMMB73_660971 [Zea mays] 64 2e-08 ref|XP_003526507.1| PREDICTED: 6-phosphofructokinase 3-like [Gly... 63 2e-08 ref|XP_003522720.1| PREDICTED: 6-phosphofructokinase 3-like [Gly... 63 2e-08 gb|AFW85828.1| hypothetical protein ZEAMMB73_244047 [Zea mays] g... 62 6e-08 >gb|AFW75541.1| hypothetical protein ZEAMMB73_660971 [Zea mays] Length = 531 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 KGGYRGFYAKNTITLTPKIVNDIHKRGGTI 3 +GGYRGFYA+NTITLTPKIVNDIHKRGGT+ Sbjct: 169 QGGYRGFYARNTITLTPKIVNDIHKRGGTV 198 >gb|AFW75540.1| hypothetical protein ZEAMMB73_660971 [Zea mays] Length = 552 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 KGGYRGFYAKNTITLTPKIVNDIHKRGGTI 3 +GGYRGFYA+NTITLTPKIVNDIHKRGGT+ Sbjct: 190 QGGYRGFYARNTITLTPKIVNDIHKRGGTV 219 >ref|XP_003526507.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max] Length = 507 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 GGYRGFYAKNTITLTPKIVNDIHKRGGTI 3 GGYRGFY+KNTITLTPK+VNDIHKRGGTI Sbjct: 132 GGYRGFYSKNTITLTPKVVNDIHKRGGTI 160 >ref|XP_003522720.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max] Length = 509 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 89 GGYRGFYAKNTITLTPKIVNDIHKRGGTI 3 GGYRGFY+KNTITLTPK+VNDIHKRGGTI Sbjct: 132 GGYRGFYSKNTITLTPKVVNDIHKRGGTI 160 >gb|AFW85828.1| hypothetical protein ZEAMMB73_244047 [Zea mays] gi|413953180|gb|AFW85829.1| hypothetical protein ZEAMMB73_244047 [Zea mays] Length = 566 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 92 KGGYRGFYAKNTITLTPKIVNDIHKRGGTI 3 +GGYRGFYA+NTITLTPK VNDIHKRGGTI Sbjct: 189 QGGYRGFYARNTITLTPKSVNDIHKRGGTI 218