BLASTX nr result
ID: Cephaelis21_contig00021763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021763 (570 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW82048.1| SGT1 [Nicotiana benthamiana] 62 7e-08 gb|ADU04390.1| SGT1 [Nicotiana attenuata] 62 7e-08 ref|NP_001234687.1| SGT1-2 [Solanum lycopersicum] gi|119214865|g... 62 7e-08 gb|ADK60779.1| SGT1-2-like protein [Arachis diogoi] 62 9e-08 ref|XP_004140745.1| PREDICTED: protein SGT1 homolog [Cucumis sat... 61 1e-07 >gb|AAW82048.1| SGT1 [Nicotiana benthamiana] Length = 370 Score = 62.0 bits (149), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 124 VESNGTVLSTNWKEVGAKKVEGSPPDGISLQ 32 VESNGTVLSTNWKEVGAKKVEGSPPDG+ L+ Sbjct: 336 VESNGTVLSTNWKEVGAKKVEGSPPDGMELK 366 >gb|ADU04390.1| SGT1 [Nicotiana attenuata] Length = 370 Score = 62.0 bits (149), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 124 VESNGTVLSTNWKEVGAKKVEGSPPDGISLQ 32 VESNGTVLSTNWKEVGAKKVEGSPPDG+ L+ Sbjct: 336 VESNGTVLSTNWKEVGAKKVEGSPPDGMELK 366 >ref|NP_001234687.1| SGT1-2 [Solanum lycopersicum] gi|119214865|gb|ABL61264.1| SGT1-2 [Solanum lycopersicum] Length = 369 Score = 62.0 bits (149), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 124 VESNGTVLSTNWKEVGAKKVEGSPPDGISLQ 32 VESNGTVLSTNWKEVGAKKVEGSPPDG+ L+ Sbjct: 335 VESNGTVLSTNWKEVGAKKVEGSPPDGMELK 365 >gb|ADK60779.1| SGT1-2-like protein [Arachis diogoi] Length = 117 Score = 61.6 bits (148), Expect = 9e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 124 VESNGTVLSTNWKEVGAKKVEGSPPDGISLQ 32 VESNGTVLSTNWKEVG+KKVEGSPPDG+ L+ Sbjct: 83 VESNGTVLSTNWKEVGSKKVEGSPPDGVELK 113 >ref|XP_004140745.1| PREDICTED: protein SGT1 homolog [Cucumis sativus] gi|449485468|ref|XP_004157178.1| PREDICTED: protein SGT1 homolog [Cucumis sativus] Length = 357 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 124 VESNGTVLSTNWKEVGAKKVEGSPPDGISLQ 32 VESNGTVLSTNWKEVG+KKVEGSPPDG+ L+ Sbjct: 325 VESNGTVLSTNWKEVGSKKVEGSPPDGMELK 355