BLASTX nr result
ID: Cephaelis21_contig00021637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021637 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002333421.1| cc-nbs-lrr resistance protein [Populus trich... 62 4e-08 ref|XP_002304055.1| cc-nbs-lrr resistance protein [Populus trich... 58 9e-07 ref|XP_002333419.1| cc-nbs-lrr resistance protein [Populus trich... 56 3e-06 gb|ABI34374.1| Disease resistance protein I2C-5, putative [Solan... 56 3e-06 ref|XP_002333623.1| cc-nbs-lrr resistance protein [Populus trich... 55 6e-06 >ref|XP_002333421.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|105922514|gb|ABF81421.1| NBS-LRR type disease resistance protein [Populus trichocarpa] gi|222836549|gb|EEE74956.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1177 Score = 62.4 bits (150), Expect = 4e-08 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 4/63 (6%) Frame = -3 Query: 178 PSTQADPNGQTDSVVDP--IVVGRTKDVFEIVKRLLSP--STEVVSVIPIVGMGGLGKTT 11 P + DP QTDS++D +VVGR DVF++V+ L S S V+SV+ IVGM GLGKTT Sbjct: 139 PEVRRDPRRQTDSILDSSAVVVGREDDVFQVVELLTSTTKSQHVLSVVSIVGMAGLGKTT 198 Query: 10 LAK 2 +AK Sbjct: 199 IAK 201 >ref|XP_002304055.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222841487|gb|EEE79034.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1091 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/62 (51%), Positives = 44/62 (70%), Gaps = 3/62 (4%) Frame = -3 Query: 178 PSTQADPNGQTDSVVDP--IVVGRTKDVFEIVKRLL-SPSTEVVSVIPIVGMGGLGKTTL 8 P D +TDS+++ +VVGR DV ++VK L+ S +V+SV+PIVGMGGLGKTT+ Sbjct: 148 PEVIRDIERETDSLLESSEVVVGREDDVSKVVKLLIGSTDQQVLSVVPIVGMGGLGKTTI 207 Query: 7 AK 2 AK Sbjct: 208 AK 209 >ref|XP_002333419.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222836547|gb|EEE74954.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 961 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/62 (48%), Positives = 45/62 (72%), Gaps = 3/62 (4%) Frame = -3 Query: 178 PSTQADPNGQTDSVVDP--IVVGRTKDVFEIVKRLL-SPSTEVVSVIPIVGMGGLGKTTL 8 P D + +TDS+++ +VVGR DV++++K L+ S +V+SV+PIVGM GLGKTT+ Sbjct: 148 PEVFRDIDRETDSLLESSEVVVGREDDVYKVMKLLIGSIGQQVLSVVPIVGMAGLGKTTI 207 Query: 7 AK 2 AK Sbjct: 208 AK 209 >gb|ABI34374.1| Disease resistance protein I2C-5, putative [Solanum demissum] Length = 1213 Score = 55.8 bits (133), Expect = 3e-06 Identities = 34/82 (41%), Positives = 49/82 (59%), Gaps = 2/82 (2%) Frame = -3 Query: 241 IYEEATNQYGLIQNFAPTLLTPSTQADPNGQTDSVVDPIVVGRTKDVFEIVKRLLSP--S 68 + E+ + GL ++F T L T + T V D + GR D+ +++ RLLS S Sbjct: 198 VLEKQIGRLGLKEHFGSTKLETRTPS-----TSLVDDSDIFGRKNDIEDLIDRLLSEDAS 252 Query: 67 TEVVSVIPIVGMGGLGKTTLAK 2 + ++V+PIVGMGGLGKTTLAK Sbjct: 253 GKKLTVVPIVGMGGLGKTTLAK 274 >ref|XP_002333623.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222837867|gb|EEE76232.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1186 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 3/62 (4%) Frame = -3 Query: 178 PSTQADPNGQTDSVVDP--IVVGRTKDVFEIVKRLL-SPSTEVVSVIPIVGMGGLGKTTL 8 P D + QTDS+++ +VVGR DV +++K L+ S +V+SV+PIVGM GLGKTT+ Sbjct: 148 PEVIRDIDRQTDSLLESSEVVVGREDDVSKVMKLLIGSIGQQVLSVVPIVGMAGLGKTTI 207 Query: 7 AK 2 AK Sbjct: 208 AK 209