BLASTX nr result
ID: Cephaelis21_contig00021632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021632 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16839.3| unnamed protein product [Vitis vinifera] 55 6e-06 >emb|CBI16839.3| unnamed protein product [Vitis vinifera] Length = 1309 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 119 AEDEYYTFFIDTSLDTHLATIISDSATVSDVKKKIVLEH 3 A Y T FIDTSLDTH+A I+SD TV+D+KKKI+LEH Sbjct: 11 ANPPYNTVFIDTSLDTHIAMIVSDVDTVADLKKKILLEH 49