BLASTX nr result
ID: Cephaelis21_contig00021598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021598 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAN77308.1| Putative GDP-mannose pyrophosphorylase [Oryza sat... 60 2e-07 gb|EEC74733.1| hypothetical protein OsI_10470 [Oryza sativa Indi... 60 2e-07 >gb|AAN77308.1| Putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica Group] Length = 376 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 116 EIGPNVSISANVRIAAGVRLISSMILDDVEIKGEGDYN 3 +IGPNVSISAN RI AG RLI +ILDDVEI GEGD+N Sbjct: 298 KIGPNVSISANARIGAGARLIHCIILDDVEIMGEGDHN 335 >gb|EEC74733.1| hypothetical protein OsI_10470 [Oryza sativa Indica Group] Length = 362 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 116 EIGPNVSISANVRIAAGVRLISSMILDDVEIKGEGDYN 3 +IGPNVSISAN RI AG RLI +ILDDVEI GEGD+N Sbjct: 284 KIGPNVSISANARIGAGARLIHCIILDDVEIMGEGDHN 321