BLASTX nr result
ID: Cephaelis21_contig00021529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021529 (1335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001655174.1| Av71 muscle cell intermediate filament, puta... 58 6e-06 >ref|XP_001655174.1| Av71 muscle cell intermediate filament, putative [Aedes aegypti] gi|108872509|gb|EAT36734.1| AAEL011208-PA, partial [Aedes aegypti] Length = 312 Score = 57.8 bits (138), Expect = 6e-06 Identities = 54/143 (37%), Positives = 71/143 (49%), Gaps = 5/143 (3%) Frame = -3 Query: 418 QNTEIMRSQDHAIRSDV*SPRRKKESKIKFPNENL*G*TSTCQIPK*SSEI-----ERRS 254 Q +E+ RSQ +RS S R +ES+++ L S + +SE+ E RS Sbjct: 118 QKSEV-RSQKSEVRSQK-SEVRSQESEVRNQKSELRSQKSKSEDRCHNSEVNIQKSEVRS 175 Query: 253 MRPEVRDPKYEARGLRPRSEGRNMKSEVCGSKSESRNPKPEVTSAEVRGRGTWLEI*GQS 74 + EVR K E R SE RN KS+V KSE R+ K EV S + R LE +S Sbjct: 176 QKSEVRSQKSEVRIRSETSEVRNQKSDVRSQKSEGRSRKSEVRSQKSEVRSQKLE--ARS 233 Query: 73 LKAEI*SPKYVARSLRAEIRGLK 5 K+EI S K RS R+E R K Sbjct: 234 QKSEIRSQKSEVRSQRSESRNQK 256