BLASTX nr result
ID: Cephaelis21_contig00021473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021473 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18544.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002267287.1| PREDICTED: tyrosine-protein phosphatase non-... 57 2e-06 >emb|CBI18544.3| unnamed protein product [Vitis vinifera] Length = 342 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +2 Query: 272 DFSPDSAPSRPALSPDQLRNCSEALRVLKDKMNASPQAIRLEFRNLQEQRLRAS 433 DFSPDS P R +L+PDQ ++CSEALR KDK+ P+ IR EF LQ R+R S Sbjct: 20 DFSPDSPP-RLSLTPDQFKHCSEALRFFKDKLQ-MPEKIRQEFAFLQANRMRPS 71 >ref|XP_002267287.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like [Vitis vinifera] Length = 339 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +2 Query: 272 DFSPDSAPSRPALSPDQLRNCSEALRVLKDKMNASPQAIRLEFRNLQEQRLRAS 433 DFSPDS P R +L+PDQ ++CSEALR KDK+ P+ IR EF LQ R+R S Sbjct: 20 DFSPDSPP-RLSLTPDQFKHCSEALRFFKDKLQ-MPEKIRQEFAFLQANRMRPS 71