BLASTX nr result
ID: Cephaelis21_contig00021331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021331 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273517.1| PREDICTED: uncharacterized protein LOC100266... 59 4e-07 >ref|XP_002273517.1| PREDICTED: uncharacterized protein LOC100266921 [Vitis vinifera] Length = 635 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = +3 Query: 54 LGRGVENLHQASQAIRQAESSRIQKSIESLLHRFRKLKVQ 173 LGRG+ +LHQASQA+ Q +S++IQKSIESL++R +K+KVQ Sbjct: 596 LGRGIRSLHQASQAVMQTDSNKIQKSIESLMYRLKKVKVQ 635