BLASTX nr result
ID: Cephaelis21_contig00021314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021314 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20168.3| unnamed protein product [Vitis vinifera] 87 1e-15 ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative... 87 1e-15 ref|XP_002285525.1| PREDICTED: gamma-glutamyl hydrolase [Vitis v... 87 1e-15 ref|XP_002331718.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_003543198.1| PREDICTED: gamma-glutamyl hydrolase-like [Gl... 82 4e-14 >emb|CBI20168.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -1 Query: 289 SEARKSLNRPPAREVLDNLIYNYTPTYCGKAGKGYDEVYIFT 164 SEARKSLNRPPAR+VLDNLIYNY+PTYCGKAGKGYDEVYIF+ Sbjct: 473 SEARKSLNRPPARKVLDNLIYNYSPTYCGKAGKGYDEVYIFS 514 >ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] gi|223536197|gb|EEF37850.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] Length = 388 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -1 Query: 289 SEARKSLNRPPAREVLDNLIYNYTPTYCGKAGKGYDEVYIFT 164 SEARKSLNRPPAR+VLDNLIYN++PTYCGKAGKGYDEVYIFT Sbjct: 345 SEARKSLNRPPARKVLDNLIYNFSPTYCGKAGKGYDEVYIFT 386 >ref|XP_002285525.1| PREDICTED: gamma-glutamyl hydrolase [Vitis vinifera] Length = 384 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -1 Query: 289 SEARKSLNRPPAREVLDNLIYNYTPTYCGKAGKGYDEVYIFT 164 SEARKSLNRPPAR+VLDNLIYNY+PTYCGKAGKGYDEVYIF+ Sbjct: 343 SEARKSLNRPPARKVLDNLIYNYSPTYCGKAGKGYDEVYIFS 384 >ref|XP_002331718.1| predicted protein [Populus trichocarpa] gi|222874324|gb|EEF11455.1| predicted protein [Populus trichocarpa] Length = 367 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 289 SEARKSLNRPPAREVLDNLIYNYTPTYCGKAGKGYDEVYIF 167 SEARKSLNRPPAR+VLDNLIYNY+PTYCGKAGKGYDEVYIF Sbjct: 304 SEARKSLNRPPARKVLDNLIYNYSPTYCGKAGKGYDEVYIF 344 >ref|XP_003543198.1| PREDICTED: gamma-glutamyl hydrolase-like [Glycine max] Length = 342 Score = 82.4 bits (202), Expect = 4e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 289 SEARKSLNRPPAREVLDNLIYNYTPTYCGKAGKGYDEVYIF 167 SEARKSLNRP A+E+LDNLIYNY+PTYCGKAGKGYDEVYIF Sbjct: 299 SEARKSLNRPVAQELLDNLIYNYSPTYCGKAGKGYDEVYIF 339