BLASTX nr result
ID: Cephaelis21_contig00021284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021284 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147231.1| PREDICTED: 50S ribosomal protein L19, chloro... 73 2e-11 ref|XP_002870097.1| ribosomal protein L19 family protein [Arabid... 73 3e-11 gb|ACF23041.1| ST10 [Eutrema halophilum] 72 5e-11 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloro... 71 8e-11 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 71 8e-11 >ref|XP_004147231.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] gi|449523724|ref|XP_004168873.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 221 Score = 73.2 bits (178), Expect = 2e-11 Identities = 53/150 (35%), Positives = 69/150 (46%), Gaps = 19/150 (12%) Frame = -3 Query: 406 MASIVLPQALCTILMNFGQSETASQKLGAFSAAVSQKTXXXXXXXXXXXXXXXSVGKVNS 227 MAS +LPQA+ +I N ++ A ++LG SA + Sbjct: 1 MASKILPQAVISIPRN--PNQCAPRRLGFCSAVSGTRVSFSTLSSSSIGSHFHHTVAAPL 58 Query: 226 HRSFVLRXXXXXXXXXXXXE-------------------KPRGMPRIKFGDVMGILNKRA 104 R+FV+R E KP PR+K GDVMGILNKRA Sbjct: 59 RRAFVVRAEANPEADSAAEEAPEAEVEAAVESDAQPEEEKPSRKPRVKLGDVMGILNKRA 118 Query: 103 IEESEEVRPRPDIRTGDVVEIKMEFSDKWR 14 IE SE+ RP PDIRTGD+VE+K+E + R Sbjct: 119 IEASEKERPIPDIRTGDIVELKLEVQENRR 148 >ref|XP_002870097.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] gi|297315933|gb|EFH46356.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] Length = 225 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -3 Query: 166 KPRGMPRIKFGDVMGILNKRAIEESEEVRPRPDIRTGDVVEIKMEFSDKWR 14 KP+ PRIK GDVMGILN+RAIE SE+VRP P+IRTGD+VEIK+E + R Sbjct: 102 KPQRKPRIKLGDVMGILNQRAIEVSEKVRPVPEIRTGDIVEIKLEVPENKR 152 >gb|ACF23041.1| ST10 [Eutrema halophilum] Length = 136 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -3 Query: 166 KPRGMPRIKFGDVMGILNKRAIEESEEVRPRPDIRTGDVVEIKMEFSDKWR 14 KP PRIK GDVMGILN+RAIE SE+VRP P+IRTGD+VEIK+E + R Sbjct: 13 KPARKPRIKLGDVMGILNQRAIEVSEKVRPVPEIRTGDIVEIKLEVPENRR 63 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloroplastic [Vitis vinifera] gi|296088907|emb|CBI38456.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 166 KPRGMPRIKFGDVMGILNKRAIEESEEVRPRPDIRTGDVVEIKMEFSDKWR 14 KP PR+K GD+MGILNKRAIE SE+ RP PD+RTGD+VEIK+E + R Sbjct: 108 KPPRKPRVKLGDIMGILNKRAIEASEKERPVPDLRTGDIVEIKLEVPENRR 158 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 166 KPRGMPRIKFGDVMGILNKRAIEESEEVRPRPDIRTGDVVEIKMEFSDKWR 14 KP PR+K GD+MGILNKRAIE SE+ RP PD+RTGD+VEIK+E + R Sbjct: 108 KPPRKPRVKLGDIMGILNKRAIEASEKERPVPDLRTGDIVEIKLEVPENRR 158