BLASTX nr result
ID: Cephaelis21_contig00021280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021280 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139980.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-l... 97 1e-18 ref|XP_002328285.1| predicted protein [Populus trichocarpa] gi|2... 95 5e-18 emb|CBI37713.3| unnamed protein product [Vitis vinifera] 94 1e-17 ref|XP_002283271.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-l... 94 1e-17 ref|XP_002514396.1| hypothetical protein RCOM_1564160 [Ricinus c... 91 1e-16 >ref|XP_004139980.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like [Cucumis sativus] Length = 550 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = -2 Query: 377 DQKESKVRELTAELQRTNQRCEVYRANLLALLRDMEDQKLKLSVKVQNARLSLKE 213 +QKE K+REL+AEL++TNQRCEVYRANLLA+LRDME+QKLKLSVKVQNARLSLKE Sbjct: 496 EQKEKKIRELSAELEKTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARLSLKE 550 >ref|XP_002328285.1| predicted protein [Populus trichocarpa] gi|222837800|gb|EEE76165.1| predicted protein [Populus trichocarpa] Length = 552 Score = 95.1 bits (235), Expect = 5e-18 Identities = 46/55 (83%), Positives = 53/55 (96%) Frame = -2 Query: 377 DQKESKVRELTAELQRTNQRCEVYRANLLALLRDMEDQKLKLSVKVQNARLSLKE 213 D+K+ K+RELTAEL+ TNQRCEVYRANLLA+L+DME+QKLKLSVKVQNARLSLKE Sbjct: 498 DEKQKKIRELTAELEGTNQRCEVYRANLLAVLKDMEEQKLKLSVKVQNARLSLKE 552 >emb|CBI37713.3| unnamed protein product [Vitis vinifera] Length = 604 Score = 94.0 bits (232), Expect = 1e-17 Identities = 45/55 (81%), Positives = 52/55 (94%) Frame = -2 Query: 377 DQKESKVRELTAELQRTNQRCEVYRANLLALLRDMEDQKLKLSVKVQNARLSLKE 213 D+KE K+R+L +EL+ TNQRCEVYRANLLA+L+DMEDQKLKLSVKVQNARLSLKE Sbjct: 550 DEKEKKIRDLASELESTNQRCEVYRANLLAVLKDMEDQKLKLSVKVQNARLSLKE 604 >ref|XP_002283271.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like [Vitis vinifera] Length = 552 Score = 94.0 bits (232), Expect = 1e-17 Identities = 45/55 (81%), Positives = 52/55 (94%) Frame = -2 Query: 377 DQKESKVRELTAELQRTNQRCEVYRANLLALLRDMEDQKLKLSVKVQNARLSLKE 213 D+KE K+R+L +EL+ TNQRCEVYRANLLA+L+DMEDQKLKLSVKVQNARLSLKE Sbjct: 498 DEKEKKIRDLASELESTNQRCEVYRANLLAVLKDMEDQKLKLSVKVQNARLSLKE 552 >ref|XP_002514396.1| hypothetical protein RCOM_1564160 [Ricinus communis] gi|223546493|gb|EEF47992.1| hypothetical protein RCOM_1564160 [Ricinus communis] Length = 107 Score = 90.9 bits (224), Expect = 1e-16 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 377 DQKESKVRELTAELQRTNQRCEVYRANLLALLRDMEDQKLKLSVKVQNARL 225 D+KE K+RELTAEL+ TNQRCEVYRANLLA+LRDME+QKLKLSVKVQNARL Sbjct: 31 DEKEKKIRELTAELESTNQRCEVYRANLLAVLRDMEEQKLKLSVKVQNARL 81