BLASTX nr result
ID: Cephaelis21_contig00021271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021271 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283175.1| PREDICTED: transmembrane protein 56-B [Vitis... 59 3e-07 emb|CAN70711.1| hypothetical protein VITISV_041642 [Vitis vinifera] 59 3e-07 ref|XP_002300864.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 ref|XP_004157742.1| PREDICTED: transmembrane protein 56-B-like [... 54 1e-05 ref|XP_004145450.1| PREDICTED: transmembrane protein 56-B-like [... 54 1e-05 >ref|XP_002283175.1| PREDICTED: transmembrane protein 56-B [Vitis vinifera] gi|302143515|emb|CBI22076.3| unnamed protein product [Vitis vinifera] Length = 267 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 340 VSVGYFLSDLGMICWLYPSLGGLEYVSVHIL 248 VSVGYFL+DLGMICW YPSLGG+EYV H+L Sbjct: 115 VSVGYFLADLGMICWFYPSLGGMEYVVHHLL 145 >emb|CAN70711.1| hypothetical protein VITISV_041642 [Vitis vinifera] Length = 203 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 340 VSVGYFLSDLGMICWLYPSLGGLEYVSVHIL 248 VSVGYFL+DLGMICW YPSLGG+EYV H+L Sbjct: 59 VSVGYFLADLGMICWFYPSLGGMEYVVHHLL 89 >ref|XP_002300864.1| predicted protein [Populus trichocarpa] gi|222842590|gb|EEE80137.1| predicted protein [Populus trichocarpa] Length = 267 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 340 VSVGYFLSDLGMICWLYPSLGGLEYVSVHIL 248 VSVGYF+SDLGMI W YPSLGG+EYV H L Sbjct: 115 VSVGYFISDLGMIIWFYPSLGGMEYVIHHFL 145 >ref|XP_004157742.1| PREDICTED: transmembrane protein 56-B-like [Cucumis sativus] Length = 274 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 340 VSVGYFLSDLGMICWLYPSLGGLEYVSVHIL 248 +SVGYFL+DLG+I WLYPSLGG+EYV H L Sbjct: 123 ISVGYFLADLGLIVWLYPSLGGMEYVVHHTL 153 >ref|XP_004145450.1| PREDICTED: transmembrane protein 56-B-like [Cucumis sativus] Length = 274 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 340 VSVGYFLSDLGMICWLYPSLGGLEYVSVHIL 248 +SVGYFL+DLG+I WLYPSLGG+EYV H L Sbjct: 123 ISVGYFLADLGLIVWLYPSLGGMEYVVHHTL 153