BLASTX nr result
ID: Cephaelis21_contig00021265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021265 (616 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635162.1| PREDICTED: uncharacterized RNA-binding prote... 58 1e-06 emb|CBI24453.3| unnamed protein product [Vitis vinifera] 58 1e-06 emb|CAA70700.1| transformer-SR ribonucleoprotein [Nicotiana taba... 55 8e-06 >ref|XP_003635162.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like [Vitis vinifera] Length = 228 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 9/50 (18%) Frame = -2 Query: 426 NRHYQHSNQAFM---------SRRTRARTPTPGHYLGLKSSRGEGYRGDR 304 NR +H NQ+ + SRR RARTPTPGHYLGLK++R GYRGDR Sbjct: 114 NRCIKHLNQSVLEGRYITVEKSRRKRARTPTPGHYLGLKNTRDSGYRGDR 163 >emb|CBI24453.3| unnamed protein product [Vitis vinifera] Length = 260 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 9/50 (18%) Frame = -2 Query: 426 NRHYQHSNQAFM---------SRRTRARTPTPGHYLGLKSSRGEGYRGDR 304 NR +H NQ+ + SRR RARTPTPGHYLGLK++R GYRGDR Sbjct: 146 NRCIKHLNQSVLEGRYITVEKSRRKRARTPTPGHYLGLKNTRDSGYRGDR 195 >emb|CAA70700.1| transformer-SR ribonucleoprotein [Nicotiana tabacum] Length = 235 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 9/50 (18%) Frame = -2 Query: 426 NRHYQHSNQAFM---------SRRTRARTPTPGHYLGLKSSRGEGYRGDR 304 NR +H NQ+ + SRR RARTPTPGHYLGLK++RGEG RGDR Sbjct: 121 NRCIKHLNQSVLEGRYITVEKSRRKRARTPTPGHYLGLKNARGEG-RGDR 169