BLASTX nr result
ID: Cephaelis21_contig00021057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021057 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306555.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002302327.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 emb|CAB10239.1| hypothetical protein [Arabidopsis thaliana] gi|7... 55 6e-06 ref|NP_567434.1| protein transport protein SFT1 [Arabidopsis tha... 55 8e-06 ref|XP_002870304.1| hypothetical protein ARALYDRAFT_355343 [Arab... 55 8e-06 >ref|XP_002306555.1| predicted protein [Populus trichocarpa] gi|222856004|gb|EEE93551.1| predicted protein [Populus trichocarpa] Length = 135 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 257 KEGLSTRQAGPSDEIQLKIDPIHGKIDKEITSILKKVRQLRNAS 388 +EGLSTR SDEIQL+IDPIHG +D EIT + +VRQLRN + Sbjct: 22 REGLSTRPMASSDEIQLRIDPIHGDLDDEITGLRSQVRQLRNVA 65 >ref|XP_002302327.1| predicted protein [Populus trichocarpa] gi|222844053|gb|EEE81600.1| predicted protein [Populus trichocarpa] Length = 122 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +2 Query: 257 KEGLSTRQAGPSDEIQLKIDPIHGKIDKEITSILKKVRQLRNAS 388 +EGLSTR SDEIQL+IDPIH +D EIT + +VRQLRN + Sbjct: 9 REGLSTRPVASSDEIQLRIDPIHWDLDDEITGLRSQVRQLRNVA 52 >emb|CAB10239.1| hypothetical protein [Arabidopsis thaliana] gi|7268166|emb|CAB78502.1| hypothetical protein [Arabidopsis thaliana] Length = 590 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/61 (47%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = +2 Query: 257 KEGLSTRQAGPSDEIQLKIDPIHGKIDKEITSILKKVRQLRNA-SFFSRNFLIFV*LSFL 433 +EGLSTR A S+EIQL+IDP+H +D EIT + +VRQL+N F S + +F+ S + Sbjct: 24 REGLSTRNAAGSEEIQLRIDPMHSDLDDEITGLHGQVRQLKNPFGFESGSVYVFLFQSTM 83 Query: 434 V 436 + Sbjct: 84 I 84 >ref|NP_567434.1| protein transport protein SFT1 [Arabidopsis thaliana] gi|75248462|sp|Q8VXX9.1|BETL1_ARATH RecName: Full=Bet1-like protein At4g14600 gi|18389246|gb|AAL67066.1| unknown protein [Arabidopsis thaliana] gi|20259643|gb|AAM14339.1| unknown protein [Arabidopsis thaliana] gi|21554084|gb|AAM63165.1| unknown [Arabidopsis thaliana] gi|26452326|dbj|BAC43249.1| unknown protein [Arabidopsis thaliana] gi|332658064|gb|AEE83464.1| protein transport protein SFT1 [Arabidopsis thaliana] Length = 137 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 7/58 (12%) Frame = +2 Query: 257 KEGLSTRQAGPSDEIQLKIDPIHGKIDKEITSILKKVRQLRN-------ASFFSRNFL 409 +EGLSTR A S+EIQL+IDP+H +D EIT + +VRQL+N + F R+FL Sbjct: 24 REGLSTRNAAGSEEIQLRIDPMHSDLDDEITGLHGQVRQLKNIAQEIGSEAKFQRDFL 81 >ref|XP_002870304.1| hypothetical protein ARALYDRAFT_355343 [Arabidopsis lyrata subsp. lyrata] gi|297316140|gb|EFH46563.1| hypothetical protein ARALYDRAFT_355343 [Arabidopsis lyrata subsp. lyrata] Length = 726 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 7/58 (12%) Frame = +2 Query: 257 KEGLSTRQAGPSDEIQLKIDPIHGKIDKEITSILKKVRQLRN-------ASFFSRNFL 409 +EGLSTR A S+EIQL+IDP+H +D EIT + +VRQL+N + F R+FL Sbjct: 613 REGLSTRNAAGSEEIQLRIDPMHSDLDDEITGLHGQVRQLKNIAQEIGSEAKFQRDFL 670