BLASTX nr result
ID: Cephaelis21_contig00020892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020892 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO42097.1| unknown protein [Arabidopsis thaliana] 55 6e-06 ref|NP_172883.2| haloacid dehalogenase-like hydrolase domain-con... 55 6e-06 ref|XP_002890048.1| hypothetical protein ARALYDRAFT_312429 [Arab... 55 6e-06 gb|AAT85766.1| At1g14310 [Arabidopsis thaliana] 55 6e-06 >gb|AAO42097.1| unknown protein [Arabidopsis thaliana] Length = 250 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 148 SGKLVKRAYDXXXXXXXXXXXXLKKPVEETYAEIGRKYGLQTTPAEIKK 2 +GK +KRAYD L KPV ETYA +G+KYGL+TTPAEIK+ Sbjct: 30 TGKPIKRAYDGLLLDAGGTLLQLSKPVHETYASLGQKYGLKTTPAEIKE 78 >ref|NP_172883.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|7262672|gb|AAF43930.1|AC012188_7 Contains similarity to a hypothetical protein from Arabidopsis thaliana gb|AC005662.2 and contains a haloacid dehalogenase-like hydrolase PF|00702 domain. EST gb|F15167 comes from this gene [Arabidopsis thaliana] gi|332191021|gb|AEE29142.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] Length = 254 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 148 SGKLVKRAYDXXXXXXXXXXXXLKKPVEETYAEIGRKYGLQTTPAEIKK 2 +GK +KRAYD L KPV ETYA +G+KYGL+TTPAEIK+ Sbjct: 34 TGKPIKRAYDGLLLDAGGTLLQLSKPVHETYASLGQKYGLKTTPAEIKE 82 >ref|XP_002890048.1| hypothetical protein ARALYDRAFT_312429 [Arabidopsis lyrata subsp. lyrata] gi|297335890|gb|EFH66307.1| hypothetical protein ARALYDRAFT_312429 [Arabidopsis lyrata subsp. lyrata] Length = 254 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 148 SGKLVKRAYDXXXXXXXXXXXXLKKPVEETYAEIGRKYGLQTTPAEIKK 2 +GK +KRAYD L KPV ETYA +G+KYGL+TTPAEIK+ Sbjct: 34 TGKPIKRAYDGLLLDAGGTLLQLSKPVHETYASLGQKYGLKTTPAEIKQ 82 >gb|AAT85766.1| At1g14310 [Arabidopsis thaliana] Length = 238 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 148 SGKLVKRAYDXXXXXXXXXXXXLKKPVEETYAEIGRKYGLQTTPAEIKK 2 +GK +KRAYD L KPV ETYA +G+KYGL+TTPAEIK+ Sbjct: 18 TGKPIKRAYDGLLLDAGGTLLQLSKPVHETYASLGQKYGLKTTPAEIKE 66