BLASTX nr result
ID: Cephaelis21_contig00020666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020666 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC63057.1| Lemir [Solanum lycopersicum] 58 9e-07 ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vi... 58 9e-07 gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri... 58 9e-07 emb|CBI35471.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera] gi|297... 58 9e-07 >gb|AAC63057.1| Lemir [Solanum lycopersicum] Length = 205 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 VCDFCKPICRDVGIYIDQDGSRRLALSEEPFLVYFTKA 116 VCDFCK ICRD+GI+I QDG RRLALS+ PF V F KA Sbjct: 169 VCDFCKVICRDIGIFI-QDGVRRLALSDVPFKVMFKKA 205 >ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera] Length = 162 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 VCDFCKPICRDVGIYIDQDGSRRLALSEEPFLVYFTKA 116 VCDFCKP+C D+GIYI Q+G RRLALS+ PF V F KA Sbjct: 126 VCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 162 >gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia] Length = 203 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 VCDFCKPICRDVGIYIDQDGSRRLALSEEPFLVYFTKA 116 VCDFCKP+C D+GIYI Q+G RRLALS+ PF V F KA Sbjct: 167 VCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 203 >emb|CBI35471.3| unnamed protein product [Vitis vinifera] Length = 2095 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 VCDFCKPICRDVGIYIDQDGSRRLALSEEPFLVYFTKA 116 VCDFCKP+C D+GIYI Q+G RRLALS+ PF V F KA Sbjct: 2059 VCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 2095 >ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera] gi|297742794|emb|CBI35474.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 VCDFCKPICRDVGIYIDQDGSRRLALSEEPFLVYFTKA 116 VCDFCKP+C D+GIYI Q+G RRLALS+ PF V F KA Sbjct: 167 VCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 203