BLASTX nr result
ID: Cephaelis21_contig00020525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020525 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD96948.1| hypothetical protein [Cleome spinosa] 49 8e-07 gb|ABW81094.1| RT6non-ltr [Cleome spinosa] 51 2e-06 emb|CAN70261.1| hypothetical protein VITISV_002224 [Vitis vinifera] 55 6e-06 >gb|ABD96948.1| hypothetical protein [Cleome spinosa] Length = 539 Score = 49.3 bits (116), Expect(2) = 8e-07 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -1 Query: 233 FALLINEEYLGFFKSTRGLCQRDPLSPALFVIAVELLSRSLN 108 F++ IN E G+FK RGL Q DPLSP LF++++E+LSR L+ Sbjct: 85 FSVSINGELAGYFKGRRGLRQGDPLSPYLFIMSMEVLSRMLD 126 Score = 28.5 bits (62), Expect(2) = 8e-07 Identities = 11/17 (64%), Positives = 16/17 (94%) Frame = -3 Query: 60 PQITYLSYADDLIIFTS 10 P IT+L++ADD++IFTS Sbjct: 143 PVITHLAFADDIMIFTS 159 >gb|ABW81094.1| RT6non-ltr [Cleome spinosa] Length = 459 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 233 FALLINEEYLGFFKSTRGLCQRDPLSPALFVIAVELLSRSLN 108 F++ IN E G FK RGL Q DPLSP LF+IA+E+LSR L+ Sbjct: 2 FSININGELTGLFKGKRGLRQGDPLSPYLFIIAMEVLSRKLD 43 Score = 25.8 bits (55), Expect(2) = 2e-06 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 72 CLNYPQITYLSYADDLIIFT 13 C N P +T+L +ADDL+IF+ Sbjct: 57 CAN-PLLTHLIFADDLVIFS 75 >emb|CAN70261.1| hypothetical protein VITISV_002224 [Vitis vinifera] Length = 430 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = -1 Query: 236 NFALLINEEYLGFFKSTRGLCQRDPLSPALFVIAVELLSRSLNLLTENFKFSSFSVS 66 +F++LIN +GFF+S++GL QRDP+SP LFVIA+E LSR + S F VS Sbjct: 201 SFSILINGSPIGFFQSSKGLRQRDPISPYLFVIAMEALSRLILRAQVGGFISGFKVS 257