BLASTX nr result
ID: Cephaelis21_contig00020515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020515 (1039 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514292.1| pentatricopeptide repeat-containing protein,... 61 4e-07 ref|XP_002280919.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 dbj|BAA25906.1| leaf protein [Ipomoea nil] 57 1e-05 >ref|XP_002514292.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546748|gb|EEF48246.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 608 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 111 LWFAWIMKDLEVHPNLVIFNSLIKGFLDVTDTKGVDE 1 L F + MK+L VHPNLVIFNSLIKGFLD+TDT GVDE Sbjct: 289 LRFVYRMKELGVHPNLVIFNSLIKGFLDITDTDGVDE 325 >ref|XP_002280919.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222 [Vitis vinifera] gi|297738818|emb|CBI28063.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 111 LWFAWIMKDLEVHPNLVIFNSLIKGFLDVTDTKGVDE 1 L F + M++ VHPNLVIFNSLIKGFLD+TDT GVDE Sbjct: 302 LRFLYRMRNYGVHPNLVIFNSLIKGFLDITDTDGVDE 338 >dbj|BAA25906.1| leaf protein [Ipomoea nil] Length = 665 Score = 56.6 bits (135), Expect = 1e-05 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -2 Query: 120 ARLLWFAWIMKDLEVHPNLVIFNSLIKGFLDVTDTKGVDE 1 A L F + M+ VHPNL IFNSL+KGFLD+TDTKGVDE Sbjct: 296 ADALKFIYKMQGFGVHPNLFIFNSLLKGFLDITDTKGVDE 335