BLASTX nr result
ID: Cephaelis21_contig00020251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020251 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540866.1| PREDICTED: 5' exonuclease Apollo-like [Glyci... 56 3e-06 >ref|XP_003540866.1| PREDICTED: 5' exonuclease Apollo-like [Glycine max] Length = 437 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 256 METGMILIDRWTQGS*AYFLTHLHDNHTHGLAPS 155 ME +I +DRW +GS AYFLTHLH +HTHGL PS Sbjct: 1 MEKRLISVDRWAEGSEAYFLTHLHSDHTHGLTPS 34