BLASTX nr result
ID: Cephaelis21_contig00020177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020177 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ38405.1| embryo-specific protein 3 [Plantago major] 60 2e-07 >emb|CAJ38405.1| embryo-specific protein 3 [Plantago major] Length = 96 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +1 Query: 1 TVYGYNTSPVTFHYDVYIPGDTWYGFNNCDRYAA 102 T+YGYN+ PVTF+Y+V IPGD WYGFN C R A Sbjct: 61 TIYGYNSQPVTFYYNVNIPGDIWYGFNQCSRVRA 94