BLASTX nr result
ID: Cephaelis21_contig00020174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020174 (494 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis ... 60 1e-10 gb|AAD37021.1| putative non-LTR retrolelement reverse transcript... 65 5e-10 gb|AAC63844.1| putative non-LTR retroelement reverse transcripta... 57 2e-09 emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulga... 53 6e-07 gb|AAC28197.1| contains similarity to reverse transcriptases [Ar... 49 6e-07 >gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis] Length = 799 Score = 60.1 bits (144), Expect(2) = 1e-10 Identities = 30/76 (39%), Positives = 48/76 (63%) Frame = +3 Query: 57 DI*NDILDKIVARLEGWKGLLLSMGGCLT*VKHVLSAIPIYSFASVSPPHSFLPRIERVC 236 D +IL ++ +RL GWKG +LS+ G LT K VLS+IPI++ ++++ P + L +R+ Sbjct: 218 DTFGEILLRVSSRLAGWKGRMLSLAGRLTLTKSVLSSIPIHTMSTIALPKATLDGFDRIS 277 Query: 237 GRFLWDSSDISQKTKL 284 F+W SS +K L Sbjct: 278 KSFVWGSSTEKKKQHL 293 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 271 KRRNWSSWGALSYSISENGLALRSLGVVFAAFACKLWWK-CKTKSGLWAKYI 423 K+++ +W + + GL +RS + A K+ W+ + KS LWA+ I Sbjct: 289 KKQHLLAWNKIYCTKQAGGLGIRSSRAMNTALLAKIGWRLLQDKSSLWARVI 340 >gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 732 Score = 64.7 bits (156), Expect(2) = 5e-10 Identities = 32/76 (42%), Positives = 48/76 (63%) Frame = +3 Query: 57 DI*NDILDKIVARLEGWKGLLLSMGGCLT*VKHVLSAIPIYSFASVSPPHSFLPRIERVC 236 D DIL+K+ RL GWKG LS+ G +T K VLS+IP+++ ++++ P S L +++V Sbjct: 288 DTFGDILEKLTTRLAGWKGRFLSLAGRVTLTKAVLSSIPVHTMSTIALPKSTLDGLDKVS 347 Query: 237 GRFLWDSSDISQKTKL 284 FLW SS +K L Sbjct: 348 RSFLWGSSVTQRKQHL 363 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 262 ILAKRRNWSSWGALSYSISENGLALRSLGVVFAAFACKLWWK-CKTKSGLWAK 417 + ++++ SW + SE GL +R + A K+ W+ + LWA+ Sbjct: 356 VTQRKQHLISWKRVCKPRSEGGLGIRKAQDMNKALLSKVGWRLIQDYHSLWAR 408 >gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1231 Score = 56.6 bits (135), Expect(2) = 2e-09 Identities = 28/72 (38%), Positives = 45/72 (62%) Frame = +3 Query: 69 DILDKIVARLEGWKGLLLSMGGCLT*VKHVLSAIPIYSFASVSPPHSFLPRIERVCGRFL 248 ++L+++ ARL GWKG LS+ G +T K VLS+IP++ +++ P S L ++R FL Sbjct: 630 EVLERVSARLAGWKGRSLSLAGRITLTKAVLSSIPVHVMSAILLPVSTLDTLDRYSRTFL 689 Query: 249 WDSSDISQKTKL 284 W S+ +K L Sbjct: 690 WGSTMEKKKQHL 701 Score = 30.0 bits (66), Expect(2) = 2e-09 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 271 KRRNWSSWGALSYSISENGLALRSLGVVFAAFACKLWWK-CKTKSGLWAKYI 423 K+++ SW + +E G+ LRS + A K+ W+ + K LWA+ + Sbjct: 697 KKQHLLSWRKICKPKAEGGIGLRSARDMNKALVAKVGWRLLQDKESLWARVV 748 >emb|CCA65997.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1363 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 24/66 (36%), Positives = 39/66 (59%) Frame = +3 Query: 72 ILDKIVARLEGWKGLLLSMGGCLT*VKHVLSAIPIYSFASVSPPHSFLPRIERVCGRFLW 251 +L+K+ + + GW+ L+M G T +K V+S+ P+Y S P S + IE+ C +FLW Sbjct: 771 LLEKVKSAINGWQAKYLNMAGRCTLIKSVVSSFPVYGMQSSLLPVSVMNEIEKDCRKFLW 830 Query: 252 DSSDIS 269 + D S Sbjct: 831 NKMDKS 836 Score = 25.0 bits (53), Expect(2) = 6e-07 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 289 SWGALSYSISENGLALRSLGVVFAAFACKLWWK-CKTKSGLWAKYIE 426 SW + + GL R L AF KL W K ++ LW + ++ Sbjct: 843 SWDRICSPTGKGGLGFRRLHNWNLAFMAKLGWMIIKDETKLWVRILK 889 >gb|AAC28197.1| contains similarity to reverse transcriptases [Arabidopsis thaliana] gi|7267156|emb|CAB77868.1| putative reverse transcriptase [Arabidopsis thaliana] Length = 1077 Score = 48.5 bits (114), Expect(2) = 6e-07 Identities = 27/73 (36%), Positives = 36/73 (49%) Frame = +3 Query: 57 DI*NDILDKIVARLEGWKGLLLSMGGCLT*VKHVLSAIPIYSFASVSPPHSFLPRIERVC 236 D+ I+D+I R W LS G LT +K VLS +P Y+ + P S RI+ Sbjct: 698 DLFTAIVDRIKQRALSWSSRFLSSAGKLTMLKSVLSTMPTYTMSCFQLPLSLCKRIQSTL 757 Query: 237 GRFLWDSSDISQK 275 RF WDS +K Sbjct: 758 TRFWWDSKPDQRK 770 Score = 29.6 bits (65), Expect(2) = 6e-07 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 271 KRRNWSSWGALSYSISENGLALRSLGVVFAAFACKLWWK-CKTKSGLWAKYIEG 429 ++ +W SW ++ S GL R + A KL W+ + S L AK + G Sbjct: 769 RKMSWISWQKMTLSFKSGGLGFRDVQTFNKALLAKLSWRLLQNPSCLLAKLLLG 822