BLASTX nr result
ID: Cephaelis21_contig00020049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020049 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271819.1| PREDICTED: disease resistance RPP8-like prot... 80 2e-13 emb|CAN75123.1| hypothetical protein VITISV_040992 [Vitis vinifera] 80 2e-13 emb|CBI25483.3| unnamed protein product [Vitis vinifera] 73 2e-11 ref|NP_175437.1| NB-ARC domain-containing disease resistance pro... 71 8e-11 gb|AAD50046.1|AC007980_11 Very similar to disease resistance pro... 71 8e-11 >ref|XP_002271819.1| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] Length = 1069 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -1 Query: 211 DSRTHDDESVRNWLREIRILAYKVEDIVETFAVEVASNRRRGVKNVLKRFACIVCEAKSL 32 D+R +DE++RN + EIR AY ED VETFA +VA RR G++N+LKR+ACI+ E K+L Sbjct: 49 DARQDEDETIRNLVAEIREAAYDAEDTVETFAFKVARRRRSGLQNILKRYACILSEFKAL 108 Query: 31 HNLGLEIE 8 H +G EI+ Sbjct: 109 HEVGTEID 116 >emb|CAN75123.1| hypothetical protein VITISV_040992 [Vitis vinifera] Length = 1191 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = -1 Query: 211 DSRTHDDESVRNWLREIRILAYKVEDIVETFAVEVASNRRRGVKNVLKRFACIVCEAKSL 32 D+R +DE++RN + EIR AY ED VETFA +VA RR G++N+LKR+ACI+ E K+L Sbjct: 49 DARQDEDETIRNLVAEIREAAYDAEDTVETFAFKVARRRRSGLQNILKRYACILSEFKAL 108 Query: 31 HNLGLEIE 8 H +G EI+ Sbjct: 109 HEVGTEID 116 >emb|CBI25483.3| unnamed protein product [Vitis vinifera] Length = 836 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/61 (55%), Positives = 46/61 (75%) Frame = -1 Query: 211 DSRTHDDESVRNWLREIRILAYKVEDIVETFAVEVASNRRRGVKNVLKRFACIVCEAKSL 32 D+R +DE++RN + EIR AY ED VETFA +VA RR G++N+LKR+ACI+ E K+L Sbjct: 49 DARQDEDETIRNLVAEIREAAYDAEDTVETFAFKVARRRRSGLQNILKRYACILSEFKAL 108 Query: 31 H 29 H Sbjct: 109 H 109 >ref|NP_175437.1| NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] gi|374095384|sp|Q9SX38.2|DRL4_ARATH RecName: Full=Putative disease resistance protein At1g50180 gi|332194401|gb|AEE32522.1| NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] Length = 857 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/69 (46%), Positives = 48/69 (69%) Frame = -1 Query: 211 DSRTHDDESVRNWLREIRILAYKVEDIVETFAVEVASNRRRGVKNVLKRFACIVCEAKSL 32 D + H+ E VRNW+ IR +Y EDI+E F ++ S +++G+K VL+R ACI+ EA SL Sbjct: 49 DEKQHESERVRNWVAGIREASYDAEDILEAFFLKAESRKQKGMKRVLRRLACILNEAVSL 108 Query: 31 HNLGLEIEK 5 H++G EI + Sbjct: 109 HSVGSEIRE 117 >gb|AAD50046.1|AC007980_11 Very similar to disease resistance proteins [Arabidopsis thaliana] Length = 839 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/69 (46%), Positives = 48/69 (69%) Frame = -1 Query: 211 DSRTHDDESVRNWLREIRILAYKVEDIVETFAVEVASNRRRGVKNVLKRFACIVCEAKSL 32 D + H+ E VRNW+ IR +Y EDI+E F ++ S +++G+K VL+R ACI+ EA SL Sbjct: 49 DEKQHESERVRNWVAGIREASYDAEDILEAFFLKAESRKQKGMKRVLRRLACILNEAVSL 108 Query: 31 HNLGLEIEK 5 H++G EI + Sbjct: 109 HSVGSEIRE 117