BLASTX nr result
ID: Cephaelis21_contig00019986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019986 (655 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283521.1| PREDICTED: probable LRR receptor-like serine... 66 5e-09 emb|CBI20142.3| unnamed protein product [Vitis vinifera] 66 5e-09 emb|CBI20141.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002283497.2| PREDICTED: probable LRR receptor-like serine... 63 4e-08 emb|CBI20145.3| unnamed protein product [Vitis vinifera] 63 4e-08 >ref|XP_002283521.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g53430-like [Vitis vinifera] Length = 1023 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 540 DLSRNYINGSIPSSFSQLPLTNLSLLGNRIGGTIPKEI 653 DL+RNY NGSIP+SFS+LPL NLSLLGNR+ G+IPKEI Sbjct: 120 DLTRNYFNGSIPTSFSRLPLVNLSLLGNRLSGSIPKEI 157 >emb|CBI20142.3| unnamed protein product [Vitis vinifera] Length = 1021 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 540 DLSRNYINGSIPSSFSQLPLTNLSLLGNRIGGTIPKEI 653 DL+RNY NGSIP+SFS+LPL NLSLLGNR+ G+IPKEI Sbjct: 118 DLTRNYFNGSIPTSFSRLPLVNLSLLGNRLSGSIPKEI 155 >emb|CBI20141.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 540 DLSRNYINGSIPSSFSQLPLTNLSLLGNRIGGTIPKEI 653 DL+RNY NGSIP+SFS+LPL N SLLGNR+ G+IPKEI Sbjct: 4 DLTRNYFNGSIPTSFSRLPLVNRSLLGNRLSGSIPKEI 41 >ref|XP_002283497.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g53440-like [Vitis vinifera] Length = 1019 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 540 DLSRNYINGSIPSSFSQLPLTNLSLLGNRIGGTIPKEI 653 DLSRNYINGSIP+SF +L LTNLSL GNRI G+IP EI Sbjct: 112 DLSRNYINGSIPASFGRLSLTNLSLFGNRISGSIPDEI 149 >emb|CBI20145.3| unnamed protein product [Vitis vinifera] Length = 935 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 540 DLSRNYINGSIPSSFSQLPLTNLSLLGNRIGGTIPKEI 653 DLSRNYINGSIP+SF +L LTNLSL GNRI G+IP EI Sbjct: 28 DLSRNYINGSIPASFGRLSLTNLSLFGNRISGSIPDEI 65