BLASTX nr result
ID: Cephaelis21_contig00019909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019909 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -3 Query: 190 LARPSKRGAGPCDLG*GLGHLACRAEGTA*GWFHRATITSLSSRWQDSG 44 LAR SK PC LG G G + RAEGTA GWFHRA ITSLS +W+D+G Sbjct: 4 LAR-SKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNG 51