BLASTX nr result
ID: Cephaelis21_contig00019861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019861 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510791.1| pentatricopeptide repeat-containing protein,... 87 1e-15 ref|XP_003556106.1| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 ref|XP_003535615.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 ref|XP_003638369.1| Pentatricopeptide repeat-containing protein ... 81 8e-14 ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 >ref|XP_002510791.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549906|gb|EEF51393.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 475 Score = 87.4 bits (215), Expect = 1e-15 Identities = 45/71 (63%), Positives = 53/71 (74%) Frame = -1 Query: 215 NFSSRSSFIENVRNDAKNIIEILWQDGPGFDAIGALDDLGVRVSGLLVRQVLLGILTNIS 36 N+S R F ENVR DA +++IL QDGPGFDA AL +L +RVSGLLVR+VL GIL NI Sbjct: 67 NYSQRKWFFENVRIDAARVLDILRQDGPGFDAKAALSELDLRVSGLLVREVLAGILRNIG 126 Query: 35 CVNKSRSAKLG 3 NK+R AKLG Sbjct: 127 IDNKTRCAKLG 137 >ref|XP_003556106.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform 1 [Glycine max] gi|356575967|ref|XP_003556107.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform 2 [Glycine max] Length = 480 Score = 83.2 bits (204), Expect = 2e-14 Identities = 42/71 (59%), Positives = 52/71 (73%) Frame = -1 Query: 218 RNFSSRSSFIENVRNDAKNIIEILWQDGPGFDAIGALDDLGVRVSGLLVRQVLLGILTNI 39 + FS R F+E V+ DAK ++E+L QDGPG DA L +L VR SGLLVR+VL GIL NI Sbjct: 68 KQFSLRKGFLETVKLDAKRVLEVLRQDGPGLDARLVLGELHVRPSGLLVREVLFGILKNI 127 Query: 38 SCVNKSRSAKL 6 +C NK+R AKL Sbjct: 128 NCQNKTRCAKL 138 >ref|XP_003535615.1| PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like [Glycine max] Length = 480 Score = 82.4 bits (202), Expect = 3e-14 Identities = 41/71 (57%), Positives = 53/71 (74%) Frame = -1 Query: 218 RNFSSRSSFIENVRNDAKNIIEILWQDGPGFDAIGALDDLGVRVSGLLVRQVLLGILTNI 39 + FS R F+E V+ DAK ++E+L QDGPG DA L +L VR+SGLLVR+VL GIL +I Sbjct: 68 KQFSLRKGFLETVKLDAKRVLEVLRQDGPGLDARLVLGELHVRLSGLLVREVLFGILKHI 127 Query: 38 SCVNKSRSAKL 6 +C NK+R AKL Sbjct: 128 NCENKTRCAKL 138 >ref|XP_003638369.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355504304|gb|AES85507.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 501 Score = 81.3 bits (199), Expect = 8e-14 Identities = 41/69 (59%), Positives = 52/69 (75%) Frame = -1 Query: 212 FSSRSSFIENVRNDAKNIIEILWQDGPGFDAIGALDDLGVRVSGLLVRQVLLGILTNISC 33 FS R FIE+V+ DAK +E+L QDGPG DA L++LG+R SG+LVR+VL GIL NI+ Sbjct: 75 FSLRQGFIESVKLDAKRALEVLRQDGPGLDARLVLEELGIRPSGILVREVLFGILKNINS 134 Query: 32 VNKSRSAKL 6 NK+R AKL Sbjct: 135 ENKTRCAKL 143 >ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 77.0 bits (188), Expect = 1e-12 Identities = 39/71 (54%), Positives = 55/71 (77%) Frame = -1 Query: 215 NFSSRSSFIENVRNDAKNIIEILWQDGPGFDAIGALDDLGVRVSGLLVRQVLLGILTNIS 36 +FS R SF+++ + DA+ +IEIL QDGPGFD ALD+L ++VSG+LV +VL GIL + S Sbjct: 64 DFSLRRSFLKDAKIDAEKVIEILKQDGPGFDTFLALDELQLKVSGVLVGEVLKGILKSKS 123 Query: 35 CVNKSRSAKLG 3 +NK++ AKLG Sbjct: 124 VLNKTQCAKLG 134