BLASTX nr result
ID: Cephaelis21_contig00019825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019825 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium eryth... 64 2e-21 ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]... 63 1e-20 gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum] 64 5e-20 gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida] 62 5e-20 gb|AEA86291.1| NADPH-cytochrome P450 reductase [Solanum nigrum] 62 5e-20 >gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea] Length = 692 Score = 63.5 bits (153), Expect(2) = 2e-21 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 FKLPADPSIPIIMIGPGTGLAPFRGFLQVRMI 98 FKLPADPSIPI+MIGPGTGLAPFRGFLQ R + Sbjct: 534 FKLPADPSIPIVMIGPGTGLAPFRGFLQERFV 565 Score = 63.5 bits (153), Expect(2) = 2e-21 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +2 Query: 146 RSIVQERLVLKEEGAQLGPALFFFGCRNRRMDFI 247 R +QER VLKEEGAQLGPAL FFGCRNRRMDFI Sbjct: 557 RGFLQERFVLKEEGAQLGPALLFFGCRNRRMDFI 590 >ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis] gi|223547135|gb|EEF48632.1| cytochrome P450, putative [Ricinus communis] Length = 692 Score = 62.8 bits (151), Expect(2) = 1e-20 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 FKLPADPSIPIIMIGPGTGLAPFRGFLQVRM 95 FKLP DPSIPIIM+GPGTGLAPFRGFLQ RM Sbjct: 534 FKLPTDPSIPIIMVGPGTGLAPFRGFLQERM 564 Score = 61.6 bits (148), Expect(2) = 1e-20 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 146 RSIVQERLVLKEEGAQLGPALFFFGCRNRRMDFI 247 R +QER+ LKE+GAQLGPAL FFGCRNRRMDFI Sbjct: 557 RGFLQERMALKEDGAQLGPALLFFGCRNRRMDFI 590 >gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum] Length = 693 Score = 63.9 bits (154), Expect(2) = 5e-20 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 FKLPADPSIPIIMIGPGTGLAPFRGFLQVRMI 98 FKLPADPS+PIIM+GPGTGLAPFRGFLQ R++ Sbjct: 535 FKLPADPSVPIIMVGPGTGLAPFRGFLQERLV 566 Score = 58.5 bits (140), Expect(2) = 5e-20 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 146 RSIVQERLVLKEEGAQLGPALFFFGCRNRRMDFI 247 R +QERLVLKE+GA+LG +L FFGCRNRRMDFI Sbjct: 558 RGFLQERLVLKEDGAELGSSLLFFGCRNRRMDFI 591 >gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida] Length = 687 Score = 62.0 bits (149), Expect(2) = 5e-20 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 FKLPADPSIPIIMIGPGTGLAPFRGFLQVR 92 FKLPADPSIPI+M+GPGTGLAPFRGFLQ R Sbjct: 529 FKLPADPSIPIVMVGPGTGLAPFRGFLQER 558 Score = 60.5 bits (145), Expect(2) = 5e-20 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 146 RSIVQERLVLKEEGAQLGPALFFFGCRNRRMDFI 247 R +QER LKE+GAQLGPAL FFGCRNRRMDFI Sbjct: 552 RGFLQERAALKEDGAQLGPALLFFGCRNRRMDFI 585 >gb|AEA86291.1| NADPH-cytochrome P450 reductase [Solanum nigrum] Length = 255 Score = 62.0 bits (149), Expect(2) = 5e-20 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 FKLPADPSIPIIMIGPGTGLAPFRGFLQVR 92 FKLPADPSIPI+M+GPGTGLAPFRGFLQ R Sbjct: 168 FKLPADPSIPIVMVGPGTGLAPFRGFLQER 197 Score = 60.5 bits (145), Expect(2) = 5e-20 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 146 RSIVQERLVLKEEGAQLGPALFFFGCRNRRMDFI 247 R +QER LKE+GAQLGPAL FFGCRNRRMDFI Sbjct: 191 RGFLQERAALKEDGAQLGPALLFFGCRNRRMDFI 224