BLASTX nr result
ID: Cephaelis21_contig00019698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019698 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517391.1| PREDICTED: protein Dom3z homolog, chloroplas... 73 3e-11 ref|XP_003539119.1| PREDICTED: protein Dom3z homolog, chloroplas... 72 6e-11 ref|XP_003539118.1| PREDICTED: protein Dom3z homolog, chloroplas... 72 6e-11 ref|XP_002326485.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_003556714.1| PREDICTED: LOW QUALITY PROTEIN: protein Dom3... 70 2e-10 >ref|XP_003517391.1| PREDICTED: protein Dom3z homolog, chloroplastic-like [Glycine max] Length = 507 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 400 DLNEGFDTFIPKKDLGSEGFGDLLACIRSKNIALQDMH 287 DLNEG+DT+IPKKDLGSEGFGDLLACIR KNI LQ++H Sbjct: 229 DLNEGYDTYIPKKDLGSEGFGDLLACIRDKNIPLQNIH 266 >ref|XP_003539119.1| PREDICTED: protein Dom3z homolog, chloroplastic-like isoform 2 [Glycine max] Length = 499 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 400 DLNEGFDTFIPKKDLGSEGFGDLLACIRSKNIALQDMH 287 DLNEG+DT+IPKKDLGS+GFGDLLACIR KNI LQ++H Sbjct: 221 DLNEGYDTYIPKKDLGSQGFGDLLACIRDKNIPLQNIH 258 >ref|XP_003539118.1| PREDICTED: protein Dom3z homolog, chloroplastic-like isoform 1 [Glycine max] Length = 507 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 400 DLNEGFDTFIPKKDLGSEGFGDLLACIRSKNIALQDMH 287 DLNEG+DT+IPKKDLGS+GFGDLLACIR KNI LQ++H Sbjct: 229 DLNEGYDTYIPKKDLGSQGFGDLLACIRDKNIPLQNIH 266 >ref|XP_002326485.1| predicted protein [Populus trichocarpa] gi|222833807|gb|EEE72284.1| predicted protein [Populus trichocarpa] Length = 532 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 400 DLNEGFDTFIPKKDLGSEGFGDLLACIRSKNIALQDMH 287 DLNEGFDTFI K+DLGS+GFGDLLACIR KNI LQ+MH Sbjct: 253 DLNEGFDTFIEKRDLGSQGFGDLLACIRDKNIPLQNMH 290 >ref|XP_003556714.1| PREDICTED: LOW QUALITY PROTEIN: protein Dom3z homolog, chloroplastic-like [Glycine max] Length = 314 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 400 DLNEGFDTFIPKKDLGSEGFGDLLACIRSKNIALQDMH 287 DLNEG+DT+IPKKDLGSEGFGDL AC+R KNI LQ++H Sbjct: 96 DLNEGYDTYIPKKDLGSEGFGDLRACVRDKNIPLQNIH 133