BLASTX nr result
ID: Cephaelis21_contig00019527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019527 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263973.2| PREDICTED: RNA polymerase I-specific transcr... 98 8e-19 emb|CBI37506.3| unnamed protein product [Vitis vinifera] 98 8e-19 ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcr... 93 2e-17 ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcr... 93 2e-17 ref|XP_002437492.1| hypothetical protein SORBIDRAFT_10g028030 [S... 92 6e-17 >ref|XP_002263973.2| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Vitis vinifera] Length = 636 Score = 97.8 bits (242), Expect = 8e-19 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = -3 Query: 203 PLNPLKVCLPSIVEEFLRVAKSSCVFAMPENFVPSGLVESELSMAFGGLERLDMFFPFDP 24 PL+PLKVCLPSIVEEFLR AK++ +F + E F+ S L+ESELS AFGG+ERLDMFFPFDP Sbjct: 470 PLSPLKVCLPSIVEEFLRQAKAARLFTVSETFIFSDLLESELSRAFGGIERLDMFFPFDP 529 Query: 23 YLLKVSD 3 LLK D Sbjct: 530 CLLKKCD 536 >emb|CBI37506.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 97.8 bits (242), Expect = 8e-19 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = -3 Query: 203 PLNPLKVCLPSIVEEFLRVAKSSCVFAMPENFVPSGLVESELSMAFGGLERLDMFFPFDP 24 PL+PLKVCLPSIVEEFLR AK++ +F + E F+ S L+ESELS AFGG+ERLDMFFPFDP Sbjct: 461 PLSPLKVCLPSIVEEFLRQAKAARLFTVSETFIFSDLLESELSRAFGGIERLDMFFPFDP 520 Query: 23 YLLKVSD 3 LLK D Sbjct: 521 CLLKKCD 527 >ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cucumis sativus] Length = 625 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/66 (69%), Positives = 54/66 (81%) Frame = -3 Query: 200 LNPLKVCLPSIVEEFLRVAKSSCVFAMPENFVPSGLVESELSMAFGGLERLDMFFPFDPY 21 L+PLKVCLPSIVEEFLR AK + +F ENF+ +GL+ES+ S +FGGLERLDMFFPFDP Sbjct: 461 LSPLKVCLPSIVEEFLRQAKVANLFTPSENFIFNGLLESDYSRSFGGLERLDMFFPFDPC 520 Query: 20 LLKVSD 3 LLK D Sbjct: 521 LLKKCD 526 >ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cucumis sativus] Length = 626 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/66 (69%), Positives = 54/66 (81%) Frame = -3 Query: 200 LNPLKVCLPSIVEEFLRVAKSSCVFAMPENFVPSGLVESELSMAFGGLERLDMFFPFDPY 21 L+PLKVCLPSIVEEFLR AK + +F ENF+ +GL+ES+ S +FGGLERLDMFFPFDP Sbjct: 461 LSPLKVCLPSIVEEFLRQAKVANLFTPSENFIFNGLLESDYSRSFGGLERLDMFFPFDPC 520 Query: 20 LLKVSD 3 LLK D Sbjct: 521 LLKKCD 526 >ref|XP_002437492.1| hypothetical protein SORBIDRAFT_10g028030 [Sorghum bicolor] gi|241915715|gb|EER88859.1| hypothetical protein SORBIDRAFT_10g028030 [Sorghum bicolor] Length = 593 Score = 91.7 bits (226), Expect = 6e-17 Identities = 46/67 (68%), Positives = 50/67 (74%) Frame = -3 Query: 203 PLNPLKVCLPSIVEEFLRVAKSSCVFAMPENFVPSGLVESELSMAFGGLERLDMFFPFDP 24 PL PLKVCLPSIV EFLR A+S+ +F N VES+LS AFGGL RLDMFFPFDP Sbjct: 431 PLEPLKVCLPSIVNEFLRQARSASLFHASVNSTHEDAVESDLSKAFGGLNRLDMFFPFDP 490 Query: 23 YLLKVSD 3 YLLK SD Sbjct: 491 YLLKESD 497