BLASTX nr result
ID: Cephaelis21_contig00019219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019219 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310176.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_002522374.1| hypothetical protein RCOM_0603630 [Ricinus c... 55 6e-06 >ref|XP_002310176.1| predicted protein [Populus trichocarpa] gi|222853079|gb|EEE90626.1| predicted protein [Populus trichocarpa] Length = 868 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +1 Query: 136 MFFNDFIQRRLASLLQPWLRDEPDIEFNLGFLHSSFTVKNFNLNTS 273 MFF+D + RRL SLL+PWL++EP+IE LGF++S T K + S Sbjct: 1 MFFHDAVYRRLVSLLRPWLQEEPEIELQLGFINSELTAKKLKFDVS 46 >ref|XP_002522374.1| hypothetical protein RCOM_0603630 [Ricinus communis] gi|223538452|gb|EEF40058.1| hypothetical protein RCOM_0603630 [Ricinus communis] Length = 1720 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/46 (50%), Positives = 32/46 (69%) Frame = +1 Query: 136 MFFNDFIQRRLASLLQPWLRDEPDIEFNLGFLHSSFTVKNFNLNTS 273 MF + ++RRL SLLQPWL+ EPD+E LG ++S +KN N+S Sbjct: 1 MFIHRILRRRLTSLLQPWLQHEPDLELELGLINSKLALKNLKFNSS 46