BLASTX nr result
ID: Cephaelis21_contig00018967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018967 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511236.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_003634185.1| PREDICTED: uncharacterized protein LOC100246... 61 1e-07 ref|XP_003608879.1| hypothetical protein MTR_4g103970 [Medicago ... 60 2e-07 ref|XP_003549840.1| PREDICTED: uncharacterized protein LOC100812... 59 6e-07 >ref|XP_002511236.1| conserved hypothetical protein [Ricinus communis] gi|255540349|ref|XP_002511239.1| conserved hypothetical protein [Ricinus communis] gi|223550351|gb|EEF51838.1| conserved hypothetical protein [Ricinus communis] gi|223550354|gb|EEF51841.1| conserved hypothetical protein [Ricinus communis] Length = 71 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 217 CNKGKTIKFKRSTSNLEEDGISSAMLLIACIGCT 318 CNKGKT KFKRS+SNLE+DG SSA+LL+ACI CT Sbjct: 34 CNKGKTCKFKRSSSNLEDDGASSAILLLACIACT 67 >ref|XP_003634185.1| PREDICTED: uncharacterized protein LOC100246199 [Vitis vinifera] Length = 70 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 217 CNKGKTIKFKRSTSNLEEDGISSAMLLIACIGCTP 321 CNKGK KFKRS+SNLEEDG SSA+LL+ACI C P Sbjct: 33 CNKGKASKFKRSSSNLEEDGASSAILLLACIACAP 67 >ref|XP_003608879.1| hypothetical protein MTR_4g103970 [Medicago truncatula] gi|355509934|gb|AES91076.1| hypothetical protein MTR_4g103970 [Medicago truncatula] Length = 67 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 217 CNKGKTIKFKRSTSNLEEDGISSAMLLIACIGCTPQKG 330 CNKGK KFKRS+SN+EEDG+SSA+L +ACI C P G Sbjct: 30 CNKGKAGKFKRSSSNVEEDGLSSAILFLACIACAPSYG 67 >ref|XP_003549840.1| PREDICTED: uncharacterized protein LOC100812292 [Glycine max] Length = 69 Score = 58.9 bits (141), Expect = 6e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 217 CNKGKTIKFKRSTSNLEEDGISSAMLLIACIGCTP 321 CNKGK KFKRS+SNLEEDG SSA+L +ACI C+P Sbjct: 32 CNKGKAGKFKRSSSNLEEDGASSAILFLACIACSP 66