BLASTX nr result
ID: Cephaelis21_contig00018940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018940 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513681.1| ubiquitin-protein ligase, putative [Ricinus ... 55 6e-06 ref|XP_002302590.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002513681.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547589|gb|EEF49084.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 378 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -1 Query: 246 VEDFTRRLNSVWPDRM*EILSMGQEWKPMSVLLNGNGSIKNM*RSLLFGSISCSI 82 VEDF RRLNS WP+RM EILS+GQE + + + +NGNGS+ G + SI Sbjct: 297 VEDFARRLNSDWPERMQEILSLGQERRLVPLSMNGNGSLSRYSGKFFLGFDNFSI 351 >ref|XP_002302590.1| predicted protein [Populus trichocarpa] gi|222844316|gb|EEE81863.1| predicted protein [Populus trichocarpa] Length = 345 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -1 Query: 246 VEDFTRRLNSVWPDRM*EILSMGQEWKPMSVLLNGNGSIK 127 VEDF R LNS WP+RM E+LS+GQE +P + +NGNG++K Sbjct: 294 VEDFARILNSDWPERMQELLSLGQERRPAQLSINGNGNLK 333