BLASTX nr result
ID: Cephaelis21_contig00018631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018631 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32813.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_002277745.2| PREDICTED: cell division cycle protein 48 ho... 68 7e-10 ref|XP_003520480.1| PREDICTED: cell division cycle protein 48 ho... 67 2e-09 ref|XP_002517276.1| calmodulin-binding protein, putative [Ricinu... 64 2e-08 gb|AAF28347.1| calmodulin-binding protein [Arabidopsis thaliana]... 62 6e-08 >emb|CBI32813.3| unnamed protein product [Vitis vinifera] Length = 956 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -3 Query: 313 LCDLENSLLELDIQNLATTTHGFVGADLAALCNEAAFVCLRCFVDS 176 L ++ENSL ++ IQ LAT THGFVGADLAALCNEAA VCLR +V S Sbjct: 581 LSEMENSLSDMQIQQLATVTHGFVGADLAALCNEAALVCLRRYVKS 626 >ref|XP_002277745.2| PREDICTED: cell division cycle protein 48 homolog AF_1297-like [Vitis vinifera] Length = 1030 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 313 LCDLENSLLELDIQNLATTTHGFVGADLAALCNEAAFVCLRCFV 182 L ++ENSL ++ IQ LAT THGFVGADLAALCNEAA VCLR +V Sbjct: 602 LSEMENSLSDMQIQQLATVTHGFVGADLAALCNEAALVCLRRYV 645 >ref|XP_003520480.1| PREDICTED: cell division cycle protein 48 homolog AF_1297-like [Glycine max] Length = 1036 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 313 LCDLENSLLELDIQNLATTTHGFVGADLAALCNEAAFVCLRCFVD 179 L ++++SL EL I+NLAT THGFVGADLAALCNEAA +CLR + + Sbjct: 595 LSEMDHSLAELQIENLATVTHGFVGADLAALCNEAALICLRRYAN 639 >ref|XP_002517276.1| calmodulin-binding protein, putative [Ricinus communis] gi|223543539|gb|EEF45069.1| calmodulin-binding protein, putative [Ricinus communis] Length = 1094 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 313 LCDLENSLLELDIQNLATTTHGFVGADLAALCNEAAFVCLRCFVDS 176 L E+SL +L +Q+LA THGFVGADLAALCNEAA +CLR +V S Sbjct: 599 LSQREHSLSDLQVQHLAVATHGFVGADLAALCNEAALICLRRYVKS 644 >gb|AAF28347.1| calmodulin-binding protein [Arabidopsis thaliana] gi|6760430|gb|AAF28348.1| calmodulin-binding protein [Arabidopsis thaliana] Length = 1022 Score = 61.6 bits (148), Expect = 6e-08 Identities = 35/86 (40%), Positives = 49/86 (56%), Gaps = 13/86 (15%) Frame = -3 Query: 322 HCQLCDLENSLLELDIQNLATTTHGFVGADLAALCNEAAFVCLRCFVDSGVTGG------ 161 H LC + +SL + ++ LA THGFVGADL+ALC EAAFVCLR +D + Sbjct: 562 HVILCGMRHSLSNIQVEQLAMATHGFVGADLSALCCEAAFVCLRRHLDQSYSSSNLPLEE 621 Query: 160 -----GSNFVS--SNDSQDNCGTGVT 104 S+ +S S+DS D+ + +T Sbjct: 622 APIAESSSSMSDISSDSSDSASSCIT 647