BLASTX nr result
ID: Cephaelis21_contig00018578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018578 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522264.1| replication factor C / DNA polymerase III ga... 106 2e-21 emb|CBI30725.3| unnamed protein product [Vitis vinifera] 103 1e-20 ref|XP_002265273.1| PREDICTED: uncharacterized protein LOC100249... 103 1e-20 ref|XP_002305724.1| predicted protein [Populus trichocarpa] gi|2... 102 3e-20 ref|XP_003547181.1| PREDICTED: uncharacterized protein LOC100793... 102 4e-20 >ref|XP_002522264.1| replication factor C / DNA polymerase III gamma-tau subunit, putative [Ricinus communis] gi|223538517|gb|EEF40122.1| replication factor C / DNA polymerase III gamma-tau subunit, putative [Ricinus communis] Length = 1105 Score = 106 bits (264), Expect = 2e-21 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -2 Query: 259 KLEQENLRLEPRSRSLLCWKASRVTRKKLSRLKVRGRKPHTLLKFVSCGRCLSGRSPR 86 KLEQENLRLEPRSRSLLCWKASRVTR+KLSRLK+R RKPH LLK VSCG+C+S +SPR Sbjct: 1048 KLEQENLRLEPRSRSLLCWKASRVTRRKLSRLKIRTRKPHALLKLVSCGKCISSKSPR 1105 >emb|CBI30725.3| unnamed protein product [Vitis vinifera] Length = 919 Score = 103 bits (257), Expect = 1e-20 Identities = 47/58 (81%), Positives = 54/58 (93%) Frame = -2 Query: 259 KLEQENLRLEPRSRSLLCWKASRVTRKKLSRLKVRGRKPHTLLKFVSCGRCLSGRSPR 86 KLEQENLRLEPRSRSLLCWKAS+VTR+KLSR K+R R+PH+LLK VSCG+CLS +SPR Sbjct: 862 KLEQENLRLEPRSRSLLCWKASKVTRRKLSRFKIRTRRPHSLLKLVSCGKCLSSKSPR 919 >ref|XP_002265273.1| PREDICTED: uncharacterized protein LOC100249702 [Vitis vinifera] Length = 1161 Score = 103 bits (257), Expect = 1e-20 Identities = 47/58 (81%), Positives = 54/58 (93%) Frame = -2 Query: 259 KLEQENLRLEPRSRSLLCWKASRVTRKKLSRLKVRGRKPHTLLKFVSCGRCLSGRSPR 86 KLEQENLRLEPRSRSLLCWKAS+VTR+KLSR K+R R+PH+LLK VSCG+CLS +SPR Sbjct: 1104 KLEQENLRLEPRSRSLLCWKASKVTRRKLSRFKIRTRRPHSLLKLVSCGKCLSSKSPR 1161 >ref|XP_002305724.1| predicted protein [Populus trichocarpa] gi|222848688|gb|EEE86235.1| predicted protein [Populus trichocarpa] Length = 1188 Score = 102 bits (254), Expect = 3e-20 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = -2 Query: 259 KLEQENLRLEPRSRSLLCWKASRVTRKKLSRLKVRGRKPHTLLKFVSCGRCLSGRSPR 86 KLEQENLRLEPRSR LLCWKA+RVTR+KLSRL +R RKPH+LLK VSCG+CLS +SPR Sbjct: 1131 KLEQENLRLEPRSRCLLCWKATRVTRRKLSRLNIRTRKPHSLLKLVSCGKCLSSKSPR 1188 >ref|XP_003547181.1| PREDICTED: uncharacterized protein LOC100793832 [Glycine max] Length = 1191 Score = 102 bits (253), Expect = 4e-20 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -2 Query: 259 KLEQENLRLEPRSRSLLCWKASRVTRKKLSRLKVRGRKPHTLLKFVSCGRCLSGRSPR 86 KLEQENLRLEPRSRSLLCWKASRVTR+KLSRLK+R RKP LL VSCG+CLS +SPR Sbjct: 1134 KLEQENLRLEPRSRSLLCWKASRVTRRKLSRLKIRSRKPRALLNLVSCGKCLSTKSPR 1191